SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|7705831|ref|NP_057199.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7705831|ref|NP_057199.1|
Domain Number 1 Region: 14-268
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.48e-68
Family Ankyrin repeat 0.0000638
Further Details:      
 
Domain Number 2 Region: 214-370
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.21e-16
Family Ankyrin repeat 0.0048
Further Details:      
 
Domain Number 3 Region: 452-502
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000667
Family SOCS box-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|7705831|ref|NP_057199.1|
Sequence length 518
Comment ankyrin repeat and SOCS box protein 3 isoform a [Homo sapiens]
Sequence
MDFTEAYADTCSTVGLAAREGNVKVLRKLLKKGRSVDVADNRGWMPIHEAAYHNSVECLQ
MLINADSSENYIKMKTFEGFCALHLAASQGHWKIVQILLEAGADPNATTLEETTPLFLAV
ENGQIDVLRLLLQHGANVNGSHSMCGWNSLHQASFQENAEIIKLLLRKGANKECQDDFGI
TPLFVAAQYGKLESLSILISSGANVNCQALDKATPLFIAAQEGHTKCVELLLSSGADPDL
YCNEDSWQLPIHAAAQMGHTKILDLLIPLTNRACDTGLNKVSPVYSAVFGGHEDCLEILL
RNGYSPDAQACLVFGFSSPVCMAFQKDCEFFGIVNILLKYGAQINELHLAYCLKYEKFSI
FRYFLRKGCSLGPWNHIYEFVNHAIKAQAKYKEWLPHLLVAGFDPLILLCNSWIDSVSID
TLIFTLEFTNWKTLAPAVERMLSARASNAWILQQHIATVPSLTHLCRLEIRSSLKSERLR
SDSYISQLPLPRSLHNYLLYEDVLRMYEVPELAAIQDG
Download sequence
Identical sequences G3QE45 Q9Y575
gi|7705831|ref|NP_057199.1| ENSP00000263634 9606.ENSP00000263634 ENSP00000263634 NP_057199.1.87134 NP_057199.1.92137 XP_018876626.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]