SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|7706111|ref|NP_057663.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7706111|ref|NP_057663.1|
Domain Number 1 Region: 53-90
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 2 Region: 125-167
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000118
Family LDL receptor-like module 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7706111|ref|NP_057663.1|
Sequence length 282
Comment CD320 antigen isoform 1 precursor [Homo sapiens]
Sequence
MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQ
CRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGT
DKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATT
MGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSA
SLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP
Download sequence
Identical sequences Q9NPF0
ENSP00000301458 9606.ENSP00000301458 ENSP00000301458 NP_057663.1.87134 NP_057663.1.92137 gi|7706111|ref|NP_057663.1| ENSP00000301458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]