SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|8923881|ref|NP_061109.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|8923881|ref|NP_061109.1|
Domain Number 1 Region: 26-360
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.02e-61
Family WD40-repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 357-403
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000103
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|8923881|ref|NP_061109.1|
Sequence length 404
Comment WD repeat and SOCS box-containing protein 2 [Homo sapiens]
Sequence
MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLEEQ
FIPKGFEAKSRSSKNETKGRGSPKEKTLDCGQIVWGLAFSPWPSPPSRKLWARHHPQVPD
VSCLVLATGLNDGQIKIWEVQTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRI
WDLNKHGKQIQVLSGHLQWVYCCSISPDCSMLCSAAGEKSVFLWSMRSYTLIRKLEGHQS
SVVSCDFSPDSALLVTASYDTNVIMWDPYTGERLRSLHHTQVDPAMDDSDVHISSLRSVC
FSPEGLYLATVADDRLLRIWALELKTPIAFAPMTNGLCCTFFPHGGVIATGTRDGHVQFW
TAPRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMKEFLTYRTF
Download sequence
Identical sequences A0A2K5NPA7 A0A2K5QGR5 A0A2K6BWV3 H9EMW7 K7C3P5 Q9NYS7 U3F4Z4
9606.ENSP00000319474 ENSP00000319474 ENSP00000319474 NP_061109.1.87134 NP_061109.1.92137 XP_011762551.1.29376 XP_011930469.1.92194 XP_015008413.1.72884 XP_016779823.1.37143 XP_017385046.1.71028 HR5664 gi|8923881|ref|NP_061109.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]