SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|90421311|ref|NP_690008.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90421311|ref|NP_690008.2|
Domain Number 1 Region: 241-342
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.49e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000571
Further Details:      
 
Domain Number 2 Region: 93-155
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000301
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.053
Further Details:      
 
Domain Number 3 Region: 14-70
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000602
Family HLH, helix-loop-helix DNA-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90421311|ref|NP_690008.2|
Sequence length 669
Comment hypoxia-inducible factor 3-alpha isoform c [Homo sapiens]
Sequence
MALGLQRARSTTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLT
ISYLRMHRLCAAGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLS
QLELIGHSIFDFIHPCDQEELQDALTPQQTLSRRKVEAPTERCFSLRMKSTLTSRGRTLN
LKAATWKVLNCSGHMRAYKPPAQTSPAGSPDSEPPLQCLVLICEAIPHPGSLEPPLGRGA
FLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAV
TGQYRFLARSGGYLWTQTQATVVSGGRGPQSESIVCVHFLISQVEETGVVLSLEQTEQHS
RRPIQRGAPSQKDTPNPGDSLDTPGPRILAFLHPPSLSEAALAADPRRFCSPDLRRLLGP
ILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQ
DADALDLEMLAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRARSFHGLSPPALEPSLL
PRWGSDPRLSCSSPSRGDPSASSPMAGARKRTLAQSSEDEDEGVELLGVRPPKRSPSPEH
ENFLLFPLSLSFLLTGGPAPGSLQDPSTPLLNLNEPLGLGPSLLSPYSDEDTTQPGGPFQ
PRAGSAQAD
Download sequence
Identical sequences Q9Y2N7
NYSGRC-90421311 gi|90421311|ref|NP_690008.2| ENSP00000366898 9606.ENSP00000366898 ENSP00000244303 NP_690008.2.87134 NP_690008.2.92137 ENSP00000366898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]