SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HmN_000348800.1 from Hymenolepis microstoma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HmN_000348800.1
Domain Number 1 Region: 648-793
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000000000366
Family Netrin-like domain (NTR/C345C module) 0.04
Further Details:      
 
Domain Number 2 Region: 375-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 3 Region: 444-493
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000121
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 4 Region: 507-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 5 Region: 570-612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.013
Further Details:      
 
Weak hits

Sequence:  HmN_000348800.1
Domain Number - Region: 128-198
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00497
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HmN_000348800.1
Sequence length 891
Sequence
MLQRSPIIVLILTIISVVYPTNTTLSHTPTPSTTSTFPNFKVVYESPSSVCYADNRAYMC
TPPFTNIAEGVPVVATSTCGQGGRPEKICQNLADGQQSHGPCEICDARKSATSRGPERLT
DRHITSNQTCWVSGRVPPGGTVNLTLSLGKRFEIFYISLQPCGPLPDSIALYKSSDFGRT
WKPWQYFSTDCYRAFGLPTSSEHSAQISSANIQEVLCVALKPPSKYNSQGGQVSNVIAFS
TTIGRSTLQSWSPALIDWMTMTDLQISLSRFPTKKKSGGSVESEKASTDASAILNRRDRS
SSQRRVSQKPPVFRLGGGGMSVNGRLYDRMLSDGDTFNSSSKLSHEKLGEGTVNEEDDRE
AVYFAFSDITVGGRCKCNGHANRCIRDRIVKTDVNGEEVVTWGPLRCDCQHNTVGADCER
CAPGYLDRPWARATNEDANVCKACQCNNHTSTCMFDINLYRKSGGRSGGVCLSCGHNTEG
VHCQECIAGYTRRSEYSIFSPNACQACECNLHSNTCTFSQHVFLLSKKISGGVCEDCRHH
TTGEKCHQCMEGYYRDWTKPVSHPRVCLKCQCHRIGSSGNRPCDRKTGQCHCKPGVTGQT
CNRCLEGYKQTRSKITPCVKAVDSLIFPGSETRSSPRSTAVKSPLDDEFCPPCEEKHSKR
FRFKKFCRRQAVFRGTVVSQEVRGELVRLGVRVHDMWRNNGEVAQRYLPLHVRHNQAPMI
PVWVPFAKQQKIGNAMCVCPRFKLGQSYLFISQAYEIPYHDRSELLLDQKSTILPWSESW
RRRLTRFAVRQERGKCDVLEEAPIYSKSRMSTGQQRRNALRNRGIIPTILDQSLPPMETQ
PRTPRHYYQQDSHYVPVNPVPQPMVPPSWNQHQYRSMRHAELPPLSQHPLS
Download sequence
Identical sequences HmN_000348800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]