SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HmN_000811600.1 from Hymenolepis microstoma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HmN_000811600.1
Domain Number 1 Region: 6-110
Classification Level Classification E-value
Superfamily Histone-fold 7.58e-23
Family TBP-associated factors, TAFs 0.0001
Further Details:      
 
Weak hits

Sequence:  HmN_000811600.1
Domain Number - Region: 292-373
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.017
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HmN_000811600.1
Sequence length 429
Sequence
MDYATDLNSDAAAHIADFWEKAKQEAECLKPEQNSFKTQDLPLARIKKIMKLDDDVKNMM
ISAEAPILFAKAAELFIRELTLRAWLHTDRNRRRTLQRNDISMAVSFGDTDQFDFLIDIV
PREEGRAHRRSQQQHTQSALQQMAGSSLVQQAQVHVVQQHASGEDVSIKSETAGQATATL
VANADGTLTTVTGGQPTVQFTTVPTATATGVSGQQIQYVIQLPASAATASNGQPFQIQML
PQQFQAASTDAVAAAQAVGGTLITTGGVAGTAATAGGLQLVHVVNQPQAATTTGTVQHQQ
AATNPTGASDGATGKLQTVHVQLSDLTSGGQTLLVEPSGAVVVASSGSSTEDGAVPGTAT
LVSVDGGETYTTAAQVFASAGASTEIPQVTTPTSSEEHIIQTSAAPTVTPSEQHAAEANR
KMEEPSVGV
Download sequence
Identical sequences A0A068XC72
HmN_000811600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]