SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HmN_000094700.1 from Hymenolepis microstoma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HmN_000094700.1
Domain Number 1 Region: 749-942
Classification Level Classification E-value
Superfamily Sec7 domain 3.27e-65
Family Sec7 domain 0.00000435
Further Details:      
 
Domain Number 2 Region: 534-703,1249-1566,1625-1755
Classification Level Classification E-value
Superfamily ARM repeat 3.92e-18
Family Plakophilin 1 helical region 0.095
Further Details:      
 
Weak hits

Sequence:  HmN_000094700.1
Domain Number - Region: 97-205
Classification Level Classification E-value
Superfamily ARM repeat 0.00238
Family GUN4-associated domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HmN_000094700.1
Sequence length 2039
Sequence
MQQTTKNSNNILPSPGENNREPQLPSVPQEFVGMFISRALEKIATEKQSRRSSNSQLRDA
CREGIEYLKARVNISDVDKSDSHLPPQSQGGALLTDEKLLLPFELACRSRNPKIVAISLD
CLQKLIAYGHVPNDAYDSSGTVRIIERIVQTICSCFSGVNTDEAVQLQVIKALLTVVTSS
TVEVHERDILLVVRTCYNIYMATKNVVNQTTARGTLTQMLNVIFQRMEQATLDAAVHHDQ
KLSEIRSHIESDTSGSVSRTSVAIHDDQKSVSEASAGSETINKRSQDGHELVDEALESET
SAMETSDKVENNGFDNESIASDNNSGDASNVNRPFDHSISDHETDTAVDRFANESDKEAM
DVVKPIENDASDHEKPGFEKKLDSENYNTESLVNKKDSDVNDQVDVSDDPTSQHEEVHYH
DKIVSEDGSEVITQGNSVSEDNKEDEPAREFQSNKAESTISSASSLNKGFSNSPSATSLD
SSDETAATEYYFAHITQKDAFLVFRSLCKLAMKPLATTNPNDPKSHELRSKILSLQLLLS
ILQQPGQAFKSNSVFITAIKQYLCVALSKNSVSSVPEVFELSLAIFLCLLNFFKQHLKIQ
IEVFFKEMLFAVLDSPTASYEHKCIVVETLQRICMDKQCIVDAYLNYDCDLERVNIFEKL
VICLAKVAQGRPAVDARTTQPQLQILRKKGLECLVLILKCMVRWSNDLFNVTNDSQSFLG
SEPASISAHQHDTDSGSSIRLNQSVEDDPEDFESRKALKEVYEKGIYLFNRGKITKGLEM
LQENNLLGTSVEHVAMFLHNESRLCRTAIGEFLGQNDTFSLEVMYAYVDCFDFSGMDFLP
SLRQFISGFWLPGEAQKIDRLMEKFAARYCSCNPNNTLFSSADTAYVLAFSIIMLTTDLH
SEKIKQKQKMSKEEYIRMNRGINDSQDLPREYLGKIYDEIAQCGMQVRSDNMPLVFSGNS
ITTTTNIGVRGIMESVSHMQSEFTSATHFEHVRPMFKLVWTPFLAAFSIGLQDCDDSLIA
HHCLEGIQYAIRIACIFRMELERDAYVQALARFTLLLSTTHSQSNSLSGAQSAVMMGNHY
RGRIDFAHGQPQGGSMSMTSLADSSSLMNPTPEMMKSKNIDSIRTLISMAQTDGNYLGQS
WLHILRCISQLESANVIATSTARSLPHRRHTSHTDEASTKAEGGRVGSEGGNSKLSRKRS
GIAPGSLAAATVDSRKAAVLQEVMGETGSRSVVVAVDKIFSGSVRLDGDAIVDFVQALCQ
VSLEELSLPQPRTFSLQKVVEISYYNIGRIRLQWSRIWEHIGQHFTTAGRSSNEDVAIFA
VDSLRQLAVKLIEKGELPNFHFQKECIRPFLNILGDINDVKPNIQDMVARCVSQLIQSQW
TNIRSGWTNIFLVLYVAAGSTEANVIEVTFNSCAFVINTVFQNNFYLLVDSFPVFIKALS
EFACNLQFPDTSMEAIRLIRLCARVVSERATQFAKEDTVPAVKTSFDTAPSGAVVSSEQG
KDDEDDAVWKRGWMPIFYELFRVINNCKLDVRTRGLTVFFEVIKSYGSSFVLSWWIQIFK
LIFSIFEHGRDTSSSAGGIPTNQQQQSPAEHAAIERNYRRRLFSGDHLEAFGITYRIFTS
PTDRSEWLNTTCNHALYSVVDIFSQFFDKIADDLLADLYVQLKWCCLQDHEQLARSGTSC
LETIVLTNGTKFDAEKWSMTVNLLVDLFKTTVPHELLTWRPDSPVYGATSDEDGVKRRQS
AQTRLFLRLLVNCIVQYELIQTVDNILFVPSRSREEDDLILRETRRSSAQLNLPLLNGTP
TPIAGAAVPLSPVSNTKQAHTPEEKRLIEAVTKDPVASPPTPSVVEPIPQMEFGEPEELV
NGSLPLHKKATIPYVSYENRLILVQCLMESHRFAKLFNSNIEQRNILWEAGFKAKAKPNL
LKQETHSLSTALRILFILSEEDRDHQKEITEMLQNTIMEAIVYYRSLPVDGHRQAWDSCL
LLTLTRLVHLTPDTRFTAIATPLYTTVCDLVGLPNLSPEISVLLRAFLLRANSRLAAAQ
Download sequence
Identical sequences A0A068XMT7
HmN_000094700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]