SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HmN_000260600.1 from Hymenolepis microstoma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HmN_000260600.1
Domain Number 1 Region: 192-443,473-519
Classification Level Classification E-value
Superfamily Mitochondrial carrier 4.71e-66
Family Mitochondrial carrier 0.0000982
Further Details:      
 
Domain Number 2 Region: 12-159
Classification Level Classification E-value
Superfamily EF-hand 8.22e-23
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HmN_000260600.1
Sequence length 532
Sequence
MRFEFPFFSIPEAISPTQKLFLQIDLDRDGLISKEDIKFFLRQFDLKLTNNNLDVLAEIF
LERCGVNSEHGYVDAKQFAHYVHEQDRHLSPIYAQMDRNMQGKVDYIDIQAYFMKLGIPI
DPDEAKHLLRRIDRNNNDCIEYEEWRKFLLFLPISNIVCVTQFWRHGAVLDLSVDPVVAI
PQFMKHEHSVKRDLLQFIAGGTAGVVSRTCTAPIDRLKLMRQVYGYKHKESGFIEAYRYM
LKEGGTLSLWRGNLINSIKIAPETAAKYTTYERYKRLLMDFDEDGFFDQHPVITKFVAGS
LAGITAQTIVYPMEVLKTRMCLRKTGQYKSLWDCAGQIYKELGFPGFFRGYGVNLVGVIP
YAGIELATYEWLKSMYIHRYMSHILQLSPRVFPDYSCGNLYVHPPSHIIPFIAATSSMLG
IIVTYPVALIRAKLQAVAYYHTKSPATPAILQSAAASGMTTGLSASLTTSIRKPEPVTVP
SLLQAIWKGEGLVGFYRGLGTNLVKVLPATAISMLTYETIRREVNLGPMGSG
Download sequence
Identical sequences A0A068XGJ5
HmN_000260600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]