SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HmN_000419800.1 from Hymenolepis microstoma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HmN_000419800.1
Domain Number 1 Region: 9-179
Classification Level Classification E-value
Superfamily PH domain-like 4.31e-28
Family Phosphotyrosine-binding domain (PTB) 0.00037
Further Details:      
 
Domain Number 2 Region: 292-393
Classification Level Classification E-value
Superfamily SH2 domain 3.23e-25
Family SH2 domain 0.0000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HmN_000419800.1
Sequence length 409
Sequence
MNDSSVLATFLIQYVGCIPVTISFKSLNFQERTQIARECIIRVCEDVGLRIPPARPVSTN
GLSKFIGRGTDLAWTRQSVRLTISVDGVTVQDFHSDQVLFQHKLSAISFASSGEADMVDF
VGYVAKSTPPTDENAEGAGEKGINEHADGGGRRCYVFFCSEGCSRDFISSIGEAFKMGYN
DFKHALQTQDFAPQPPPRPVIDDLDPPLPQAPSPPVPVDPWFAPQSKVLNANGQGSHDQF
DDSAWLLQDNPPIAPVSSQPANWVAFSSNPQPPSHQEPGQPLPFGSNGNSAPSSVELEQS
VRSLEPVGEPWYVGQITRQKAEALLQYDGDFLVRASTQQPNQFVLSGMQNGKKRHLLLIN
PEGQVRTKDRIFSSIQELIDFHLRSTTPIRSADNELKLVFPVSPNYLDQ
Download sequence
Identical sequences A0A068XQ58
HmN_000419800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]