SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HmN_000781200.1 from Hymenolepis microstoma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HmN_000781200.1
Domain Number 1 Region: 436-521
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.43e-17
Family Ras-binding domain, RBD 0.0065
Further Details:      
 
Domain Number 2 Region: 570-680
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000216
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Weak hits

Sequence:  HmN_000781200.1
Domain Number - Region: 155-160
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0471
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HmN_000781200.1
Sequence length 795
Sequence
MAGETEFCLVTAGRTEHNWWTDMDSELSELDDWVGTLEELQLGLEKKCPPTSSSNHLSSN
SISPSPSSKASLYSGPHHISRTPVTPSSSPWRAAQMLDSPPPPALPPCRDFPIMSSKQVN
SNPPPPPPLFENEDNEGRRRVSTLTQSIRASFNTLSWKEETAENDLNCLLRQLEEVENTM
KQLELDDGDFTRRYSLASSSTTDPNTGCNPSPAPDAPEQSISSPILPPPLPPLPSNGYGN
GYIGYSNGYTNRPTTADNQHSVDRVTLRPALIPQNLPTSARPSSPSDYELAEEALLPTEP
KFTSVVPHDAGLSGDTRSVMKERYHNNDNGAPVERHRSLDMAPPTLPPPIQTTPVMNRLS
AFDSPTTSSGCSSSISAAALHQKPPFQSSPNQNNRLGNITPAVCASNEGSLSDKSMSECP
EISKKLNQVVDLADRLQLNKLVVRIFRPDKTTKAILIDQRMTAGEVASMLIEKNFLEPSV
KLCLVEKVPSLKVERVFEETETVADCILSWPVKSQNMIFFEVREDHFGFIESPKDWLGEA
FANANGFHSAESVQKMLLNFTSSGLAEWHDFLYIRKPGEKTWTRRMCVLRNSGLYASKKN
KKTFSLSDLVRLLVLDDKLHIYTTTGGWSRMRAPTPHGFALKTYAAQDFSSSHVFCFCAP
DEAALKQWACRLRLAKYGISLLRDYQIARERMNTNLGGDTQMPNSTIELKKVMRQSSVDY
ARPYTVQTPRRQASAGNLNAIKPMCTPQIGQQRVASLTPQPTSVVLRHSQFETSMNGNDY
KHHSTGVPPQHFYIR
Download sequence
Identical sequences HmN_000781200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]