SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HmN_000818000.1 from Hymenolepis microstoma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HmN_000818000.1
Domain Number 1 Region: 27-128
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000261
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0087
Further Details:      
 
Domain Number 2 Region: 175-279
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000484
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HmN_000818000.1
Sequence length 375
Sequence
MAEALMEASDKLSSLDRSQLADLVPLHCSTICDAVAILYMGVLGKWVKVSSGVAALEGNK
KDHKLHICLYSLTKRLKVFDIELYEEMNYTVSCCQFHSFSDDGGSYGLLFSNVNDSQKFF
EHVNGFLKTDNLSDEATSKIGWINRKKFNNFFVKRNKSSNRKNDKKLNIEVKVNTFKHVS
HIGLSQDAGFKVSAESEELANELIKALNLTINDEMEMQVVRETINKFGSDNVKEAMEQKR
LKQQVPQPPSSQQRPPLPARPISSLQQPPPSSRQLPPPPLPARPMSSLQRSPSTSQPIPP
PPIPPVSVPHTQSMHGELLDSIVNFNPNKLTKVNTAERKESAPDLMDSIENALIQMLNQR
RGLLTQSDTDEDSDF
Download sequence
Identical sequences A0A068XEU9
HmN_000818000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]