SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HmN_000827000.1 from Hymenolepis microstoma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HmN_000827000.1
Domain Number 1 Region: 268-413
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.56e-24
Family Canonical RBD 0.0028
Further Details:      
 
Domain Number 2 Region: 547-583,627-770
Classification Level Classification E-value
Superfamily SPOC domain-like 1.96e-23
Family SPOC domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HmN_000827000.1
Sequence length 777
Sequence
MKRIGRRDSPIHSRYRRDESNGRDSNSYRNYGVQNSRSRPMQQSPPYERHNPRSGCSSFS
RSQRDYDDSGRQSGSGSFRSGPPVRRFNQRSGNSGGNRSSDMYDQGSHSDRLLQGLMASG
DLIGQSGTKIDPVFAAAAAAALNATFSATNSKSSSGNMYSPNSSAVAAVAGAAMNAAAIA
AAIGGGQSPSNGSSFQFPGLGGSHHSLKSCGGGNRSPHYDRRGGGGDGCHSSRTRDRLSP
PYRSDGRRSTITSTADGHPTPEDDPTATRTLFVGNLPPDIRASQLQQLFDVYGIIEDIDI
KRPQNGSPNEPAYAFIKFVNVSMAYRAKLGMAGKRIDGYVCKVGYGKVSPTRCLWVGGLG
PWTTYPNFASLVERVSRPKKIIWPSGKGYANILFYTSEEAASAANSLRGVHIGTGGNHRL
RVDFTDESHMVNSGTIDSLRRGRPGALDSRKQRFKREGNRHQRSVSRSPPRRSPVRRSRS
FSSPSRGAARSPSASGDGGRISRSPTSPQSHSRTHSPAVGVSDDLVGMPEANSSCGIGDV
TSCLSGPVWKAVFALKKSNFSCHLYAVTGDTDLADQLFPRHHPKPPQTPPDDEEEAEIGE
AEDSKGRADRNATVLDSKTPVVAAVNSPLLRISQRLRLNVSKCEEIKKRMKTVNRGDFCM
LLATESANEVVPTVIKAEDADNHNRQLTDLITYLASKEAAGVVVVSADGLEGQCDGEDQQ
QQSFLDSEHSRVLHVLPPGDLSVALLVEGGISCLRQKRVEAGDNYLVILLSKNSGFM
Download sequence
Identical sequences HmN_000827000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]