SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HmN_000854900.1 from Hymenolepis microstoma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HmN_000854900.1
Domain Number 1 Region: 620-659
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000327
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 2 Region: 682-720
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000393
Family LDL receptor-like module 0.0038
Further Details:      
 
Weak hits

Sequence:  HmN_000854900.1
Domain Number - Region: 984-1185
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000618
Family Eukaryotic proteases 0.026
Further Details:      
 
Domain Number - Region: 566-590
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00249
Family LDL receptor-like module 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HmN_000854900.1
Sequence length 1385
Sequence
MGKSKGHELKKFYGKLGFNYEQNKYDTIIGFSHVVSVIAKELCDIYKLNFIVNEIPSNSP
DGDKNSKSKQSFLLEFSDFLREYGFPYMELIQGDISTRFASPKHRAIILKFLCAELVVAR
KMCKEGQQNGNQSEHSQITSDISEHFSRACHALGLSQPPLGTDVSTLLATLFESTSKALK
TAPPNYIGMPMLPITGLSDDQWTKICDIGQVLDTEYTSRRETLIKRADCTVQSFKWSDCG
KAKMEEIERTYNPLRGAMKLRPWLNMIPHILAARDVQLLRLEKTSSGLAREFTTTPLNRI
LMSEKVPDRGGRAWETEAPPPEMPSFKKRQAGGGRGGADRGNRGSRGGGRGGGRGGGRGG
DGVGGGRGGFSANDSFGHVSGSSDSRPQTGISFERQDGPMRSPGDIVFQPQFFGGHGAKL
SSNQLAFGQGIKVIEFHSSNLHGECSWRIDSNKESPALFKITLLENNFADLNPNCLNSSH
IVITDSNNASVAYCTYLKNRELRIFSKFVKIEIISFDKSLEDQYAKFSYEIIDLGTRLMS
PVCSHIKEQHHRFWPCKTRFDSDSFSDTVCISSTQICDGIIQCPGSEDEDVEICDALKST
SFKLPPLRDEELIGPVGNEPCPNNAFYCHNDAKCITSANVCDGVQDCLGNMDESPIACDW
KKEKSDILNYNATNVDEKSASCNKDYKILCPAENICLPVSVVCNGIIDCSDGYDEAAQAC
KAIGDLEQHLIEKESSDDISMSTDEIVSKIPHEQEIGESTTNTCEISSSESINYSGSTIK
QVENSETTSSNASVTPEEGIPETTEVSTNSMDKGIEASERSYVDIDTTHKPNPDTFTTPT
SETLNDYTIATNISVESPITGTREILVETGPRLENASWTTTDDASEGSSSELKAETGTFK
NSLKNSNSSTVIPEALAIGAPLEKSNQTMQLLQPISEPEGISLESTSELPNEFPDSTIEP
EELNLKKLAIFANDEGEIVFPPLWVARVSSGFIFLCYGILLDLESTFRWVLIPSSCGQYL
EPSRMRVHFGAGIDKYEVTARVNQKWDNQTTGSGFSLLQLNSSECVKHFIPQGISLNNSS
LTPNNTETICKLLAPRHGYIFSFQVQNVHKEDSITCKQAYEKGDVVSCFSQNLCLQSGLG
GILTCPNSILGFYTEGADCYQGQIGWPVMASLITPEITNWIKYIVSMGHTNQCGYSPNEK
SQFFQWYTYFNRTQSSEGLCLVAYVRNDTFPLVTSVQCLKQCMNSIPPKSDEEIGCELDK
YEADMELCPAKNIIKRLSTPESPWTQCLIAYLPSPTKKEIKFEPVRISAFKDCDGESFYN
PFMADTNLCVRAMEDDGVLNCSSWGEAGLVQCKRSSDGLWEFLGFTKSCSARKPRRRWFI
RSLEL
Download sequence
Identical sequences A0A068XAL3
HmN_000854900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]