SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|376297933|ref|YP_005169163.1| from Desulfovibrio desulfuricans ND132

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|376297933|ref|YP_005169163.1|
Domain Number 1 Region: 935-1103
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.67e-35
Family Histidine kinase 0.002
Further Details:      
 
Domain Number 2 Region: 418-533
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.59e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.018
Further Details:      
 
Domain Number 3 Region: 707-829
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000137
Family Heme-binding PAS domain 0.046
Further Details:      
 
Domain Number 4 Region: 853-945
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000012
Family Homodimeric domain of signal transducing histidine kinase 0.0033
Further Details:      
 
Domain Number 5 Region: 546-698
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000027
Family GAF domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|376297933|ref|YP_005169163.1|
Sequence length 1107
Comment multi-sensor signal transduction histidine kinase [Desulfovibrio desulfuricans ND132]
Sequence
MRKGRTIGGAGLLGMVAVSWISILVIGGTWLYSMYADFQADADRIREERYAERRSLVKGE
VDDAIELIARLRRSAADTLGRRLDSRMRDVRALNEVLARDLAKGTDGTVLRIATVRLMAA
LDRSEARLYAIRDNTIYLFSPFPKWVDREDALTQVEAELEGVTNGQRRLDLKVADGMNGY
TLLVKVNEFGAHGLRVVAGACLEMAEETVKETALRQLADIRYAKNGSLFGGTMEGVSILG
PVPGRNMWAVTDANGVKIVQELIAAAKRGGEFVNYVMPPLSGERNEPKVSYARLVPDWGW
YIGTGAFVGDIEGVVELKRKQLEQHIQDRGLLILSGMAALSLLALYLSRRLARNIENNVA
SFTTVWKRAASGRGEIDVASLDYAEFKTLAEAANHMVAERQTAQEALSESLERFSSLVAN
VPGIIYHSDFRGVWVNRYISDTVLDVTGYPAEDFMEGGGRTFQSIIHPEDREWVAQSLRQ
GLEHRQTYLADYRIIRRDGEIRWVSERGRILHDEQGGPERLDGVVFDVTDRKHAEEEYYN
HIHFLETLDRIDRAMHVGTSTREMLGTTVEAIRVAFGADRAWLLKPCDPEADEFRVVVNE
TSPEFVVEEEVVLAVDDNIRRDMRMLLDSPVPLAFDPFSGRTVPREITDRYDIRSQLMFA
IRPRVGPALVLGLHHCREPRVWTSEEIRLFTEAGRRLADGLNVALILDELTESEERFRTF
SEQTMLGLCVLQENRVIFINRAAADIVEAPVEELMALPPGGFVRYLHPDDSDFVVEQARR
KQAGEADTVSAYSWRAVTGTGRVKWVEIHSRTTRVNGKSADLVSLVDITALKRAEEDLEA
IIAERTSALALKAEELKRANTELTRLDDLKSSFLTTVSHTMRTPLTSVLGYGALARKELD
RALGGAGNSESLHRALGNLDVLEAEGRRLNLLVEQFMELADMEAGGDLRTEATYPVAATI
RRAVEDARAECIGRDRLEVTLDMEENLPELNVLPEHLERVLGHLLGNACHFTRDGKISVR
VASPDGKGLELTVADTGKGIPEEELEAIFKPFHQVDTGDTLVDEIKGAGLGLALCRMVVE
KLGGRVWARSEGGRGAVFHVILPGGRD
Download sequence
Identical sequences F0JKB1
gi|376297933|ref|YP_005169163.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]