SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390937761|ref|YP_006401499.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390937761|ref|YP_006401499.1|
Domain Number 1 Region: 10-168
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.54e-35
Family G proteins 0.00097
Further Details:      
 
Weak hits

Sequence:  gi|390937761|ref|YP_006401499.1|
Domain Number - Region: 107-159,188-267
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0176
Family G proteins 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390937761|ref|YP_006401499.1|
Sequence length 280
Comment GTP-binding protein HSR1-like protein [Desulfurococcus fermentans DSM 16532]
Sequence
MSRGGFILASWSQLDRMISRVDVVLMVLDARDPLSTFSKRLESIVRERGKKLILVLNKSD
LVPRNVVEEWKRYFMEKGYTTVYMAAARHMGTLRLRRTIRRVAPLLPTIVAVTGYPKVGK
SSIINGLKGRHSAPTSPYPGSPGYTRHFQLYRVDKDILLVDSPGVIPVEGGELERVIRGY
PIEKLEDPVLPAMKLIERIMTYHPDAFMEAYGVSERDPLRILEEIAVRHGWFYKTTREPL
IEEAARKVIRDYHDGVVKFYIRPAWIRDIGEPYDQGEGDR
Download sequence
Identical sequences I3XPQ0
WP_014766829.1.2099 gi|390937761|ref|YP_006401499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]