SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390937783|ref|YP_006401521.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390937783|ref|YP_006401521.1|
Domain Number 1 Region: 324-439
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.00000000000719
Family Pseudouridine synthase II TruB 0.013
Further Details:      
 
Weak hits

Sequence:  gi|390937783|ref|YP_006401521.1|
Domain Number - Region: 164-202
Classification Level Classification E-value
Superfamily THUMP domain-like 0.000802
Family THUMP domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390937783|ref|YP_006401521.1|
Sequence length 442
Comment THUMP domain-containing protein [Desulfurococcus fermentans DSM 16532]
Sequence
METPQQNRCGEHCSIIETAAKILSEYPLCDRCLGRVFAKKGIELSNEERGRAIKTLLAMK
LYTDYTSEIIDAEYIGKIASNTGDPVTRLYRKITGREIFANPCHICLHRVSSDYIDEIAR
RVAVKLSELNASSFIIGVKLDSEVVKKELDVHVLTGLESSESLKNELKREIGKRVTQLTN
IPPDFDKPDVVVIVDVNKDFDYSIQTQVNPILLKAIYFKRGRRISHVPWFTSNGSRKYPE
SIQDFIRDSIASLFDARDIKIHAAGREDVDARMLGSGRPLVIEVKEPGFRNVDLDLLNYI
LDDQFIKVSVIGAATRRDIESIKEGSRKRRKIYRVTVLTEKPVSEGDLEKLSSFFKERSV
KQRTPMRILRRKKDRERIKRVHRIEVISVSSRVFEALIYCDGGLYVKELVHCDNGRTTPC
FSEILGTPAYPLELDVLYVEKA
Download sequence
Identical sequences I3XPS2
WP_014766851.1.2099 gi|390937783|ref|YP_006401521.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]