SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390937911|ref|YP_006401649.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390937911|ref|YP_006401649.1|
Domain Number 1 Region: 5-163
Classification Level Classification E-value
Superfamily PRTase-like 1.27e-34
Family Phosphoribosyltransferases (PRTases) 0.0000713
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390937911|ref|YP_006401649.1|
Sequence length 183
Comment phosphoribosyltransferase [Desulfurococcus fermentans DSM 16532]
Sequence
MVHQKVKTRYISWSMLHESLKNLAEKISSEYAADTIIAIAKGGLIPARILVDLLGIDEMG
FIEVKFYRGIAETREKPYVTFTALPQLDNKRIIIVDDIVDTGRTLQVVADVLSRFKYRDM
KFATLYVKPWSTIMPDYYSEIVDEWIIFPWEICESIRENAELKGVDVGGILDYCKRKHGS
QSL
Download sequence
Identical sequences I3XQ50
gi|390937911|ref|YP_006401649.1| WP_014766978.1.2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]