SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390938366|ref|YP_006402104.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938366|ref|YP_006402104.1|
Domain Number 1 Region: 6-183
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.1e-43
Family GHMP Kinase, N-terminal domain 0.00018
Further Details:      
 
Domain Number 2 Region: 198-291,322-403
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.32e-21
Family Mevalonate kinase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390938366|ref|YP_006402104.1|
Sequence length 415
Comment GHMP kinase [Desulfurococcus fermentans DSM 16532]
Sequence
MIDKIGMAFKEFYGEKPSIVVSAPGRLDFLNTHQDYKGLPVSAIGVNLRTYIALAPSNNG
VMAYSENLNAVDEFQPEEITLRGGKWFGDYIRAVFKVFTEEGYRIKGFKAYIASNIPVAS
GLASSAALEVAVAWGISELNGLGLSRKDIAEYAFKAENKVMGIPCGRLDQYGSAFGGVTL
IHTRPPYNVEELGFREGVWLVVDSGIRHSTADIHPRLQGEIDRALNELMSIVPPGLKNKL
GYRYWEPRWEELTLDELTPYLENVNRTGARRIEFTIRMYSSTMLAVKALKGLKPTVGEVV
KVLGSELAEPERVRSILSSNTWRLELIGLVMNHQHYLLSKLYDVSLPEIDRIAEEMNKLG
ALGAKLSGAGLGGSVIALFRDRDTAGKALKGVLDCCAPRGWIVEIDEGVKTHGDR
Download sequence
Identical sequences I3XRF5
gi|390938366|ref|YP_006402104.1| WP_014767430.1.2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]