SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390938389|ref|YP_006402127.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938389|ref|YP_006402127.1|
Domain Number 1 Region: 50-177
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000000645
Family ATP-dependent protease Lon (La), catalytic domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390938389|ref|YP_006402127.1|
Sequence length 612
Comment serine protease-like protein [Desulfurococcus fermentans DSM 16532]
Sequence
MISVTLSHGNRLAAGVLTVLITVYIIVQPVVGVEYWSRASAFKLLAVDENGRGVTISVEL
GIVYPGTGSLKVLGEGSLASDTLDSIKLALWYASILADLDPSVIDTYIMVKEPVKIEGPS
ATVLFTLILVALMRGDPVNPSYSATGIVTPGGVIGGVGGVKAKFEAASEADLKRVLASIM
EPVDSPLYYPSITLLDAYYGFTGVNITSRVELIPQQLIAGNTILSGFNESYTYFINQYRV
FNSLLPGAWSDHYRETAIYYYERALKAYEAGSHYLAASYAFTSFYNILASYLNHTNINNP
AELPEKISYFMTEANSTLVNVENLLHNVTSRLLNKGAIDICIIDSLTSVYDRVLEVKRGI
MLINNVLNKTLHPPSIIYDVSYLYARSLTALKWLELASGIIYECSDNHLIDPGNIDPILD
RLEEALRIHYAYLNDLTNSSMVLVMDESTNKLERLIYLLSALEDLASQFYSLTGLENTLP
TYVNSTIYDMLLDEYGELLSLLREGSVVTNTLPLNTLTLMELVNGNATVLGGNTYSATMV
LREFSRLYTYLYLARIQKWNETSSHIHTWLNIRMYIAYTSALLAVVGVLVMLTTGKTRSR
ATSPGITAWRNH
Download sequence
Identical sequences I3XRH8
gi|390938389|ref|YP_006402127.1| WP_014767453.1.2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]