SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390938427|ref|YP_006402165.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938427|ref|YP_006402165.1|
Domain Number 1 Region: 7-83,174-355
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.9e-66
Family Bacterial dinuclear zinc exopeptidases 0.00000524
Further Details:      
 
Domain Number 2 Region: 73-182
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 2.44e-32
Family Aminopeptidase/glucanase lid domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390938427|ref|YP_006402165.1|
Sequence length 366
Comment cellulase [Desulfurococcus fermentans DSM 16532]
Sequence
MEWRGQYIELIKKLTSLHAPSGREDPVKDLVAELMKPHVDKLWIDVWGNVVGYRKGSKGS
GKIMIAAHMDEIGLFISHIEDDGFLRVIPIGGVLERTLLYQRVIVRTRDGKLYRGVIGLK
PPHVIKPEEAQKVPELRELFIDVGASSKEEVEKMGIRVGDIAVFDREVAELGWNRITGKA
FDDRVGVVVMLKALEMLEKHDVDVYFVATVQEEVGLKGAKTSAYGISPDVALAIDVTIAS
DVPGVAKSEWFTRLGYGPAIKIVDGRNASGLIAHPKVVEFLVSIAEKKRIPYQLDVISGG
TTDASTIALNKEGVAAGTISIPSRYIHSPVEVVDLRDLYNASLLAKAFIEEATPEWIQSI
KGVVIK
Download sequence
Identical sequences I3XRL6
gi|390938427|ref|YP_006402165.1| WP_014767491.1.2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]