SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390938437|ref|YP_006402175.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938437|ref|YP_006402175.1|
Domain Number 1 Region: 233-374
Classification Level Classification E-value
Superfamily vWA-like 0.0000178
Family Integrin A (or I) domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390938437|ref|YP_006402175.1|
Sequence length 439
Comment hypothetical protein Desfe_0701 [Desulfurococcus fermentans DSM 16532]
Sequence
MAIHATTRLKLYMLSTALLLAGAIIVDPTFLTPALLLLSLPVFSYIAIESNYKILKSIKV
SGSVAMETGGRFFVEYTIINPTRIPILPVEFSIQYSELIKLVKGSKRGLLIIPPRAKVKL
RFSFHGRLGEHFVGPLKIVLRDLFGFYRSSDEYLGKALVVNIPPTVEEVIVRKLLIYARS
TGLVKSRIPGEGVEFYDIRDYSPGDEAKRIVWRIYASRRMLAIWEPEKEAFQPVLFILDG
TREMWSGPMGQSMIEHSARIISSIIYYLVKRGYPVSATVFNESLVHTSGKPMHGYHGYME
ALRALSKVRFEEGDESHRRRALSGVLSYMYTRILPRDRSIIFLFTHLRDTIIDEIAAWNN
LYKDKGHILYIVHPLITAYESDSDVPEWVANIYRVKLIEGLREDMAVISRARGRGLKVIA
VTPDLIPQRVMDIIERYSS
Download sequence
Identical sequences I3XRM6
WP_014767501.1.2099 gi|390938437|ref|YP_006402175.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]