SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390938570|ref|YP_006402308.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938570|ref|YP_006402308.1|
Domain Number 1 Region: 263-401
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000479
Family Ku80 subunit N-terminal domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390938570|ref|YP_006402308.1|
Sequence length 426
Comment hypothetical protein Desfe_0843 [Desulfurococcus fermentans DSM 16532]
Sequence
MSSENKEGYLRGVDYGDPVVRYRGGKIKRLAELFAGRKLGISNEFAADIFYLFYLPVPLL
REDDPGGGEEYRVLRALKDSPNFPIVKSRTIMDSFISSIAASVFLSEVKLLEEVAGKSKV
ESGQMDVNENTEVSRIVEKALTTVNIDIENVKKLKSIVEGLEPGSTSQLSLDEDVAEVLK
LARDIDVKRILEMLKGLKPWELGVEKKKRRFKHGEIAGYEYGRDLERIVPSNLILPSEVF
YTRFAQRKLLLYEKVVEESLGPMYVLLDKSGSMDGVKITWGKAVAISLYLKAVKTHREFY
LRFFDSQPYPLYRIGRIYKPSEVLKLLDYIARVKGAGGTDISRAIITACTDIRTGSIGRE
SDIILITDGVDRIAENMVRYNLKKTDSRLITVMIMGDNENLRNISYKYLKIEKLDKAGML
RVVEFD
Download sequence
Identical sequences I3XS09
WP_014767633.1.2099 gi|390938570|ref|YP_006402308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]