SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390938829|ref|YP_006402567.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|390938829|ref|YP_006402567.1|
Domain Number - Region: 190-325
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.00314
Family FolH catalytic domain-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390938829|ref|YP_006402567.1|
Sequence length 504
Comment aminopeptidase Iap family-like protein [Desulfurococcus fermentans DSM 16532]
Sequence
MVGVIEPGSASEKKFLETLREMLDEYFDWVTIYETPVLRWEWSKCVIEINGEEYKCRPLP
YTLTGVGEGRGLTAKGVSRELGGKVLLHEYPSNIHELRFIVGEALKNGAEAIVFMHEGGR
PWNTAVLSSSIPVLKPDTPPGIPVVVLESNPRGMSGFNGERIRVETEARIYDGVGRTMLA
GMSNGDKVKVHVSTHHDGIPDDRGYMGKYIGLLRDILTIATRHSDVEVVFVSYTANEIGD
PQLNSYTWSWGSRYLLEILESKNLLDNTLLDINLDFKGDVFEIIDNPIPLLPNLDTVNKG
KTHFGFDSLVYLNHGIPSVTISGLSPGNVERDIYKDIGYVIEALLKIVEDPESMLKRLWS
ELVKKHDAAPLEYRSSVTRIYESSRITGVFNAVKALITYTSALASLYVITGSEFHSCITH
APLYSLLGEYMNRVKYRLGERGRIIVWSLDNIILDAGVRLEPSLINSILKRIESFMLIKI
DELLNNILELQVCRRSIQGASDER
Download sequence
Identical sequences I3XSR8
WP_014767888.1.2099 gi|390938829|ref|YP_006402567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]