SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390938922|ref|YP_006402660.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938922|ref|YP_006402660.1|
Domain Number 1 Region: 59-253
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.97e-47
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00046
Further Details:      
 
Domain Number 2 Region: 592-738
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.58e-39
Family AlaX-like 0.002
Further Details:      
 
Domain Number 3 Region: 316-498
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 2.48e-38
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00015
Further Details:      
 
Domain Number 4 Region: 501-576
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000847
Family AlaX-M N-terminal domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390938922|ref|YP_006402660.1|
Sequence length 908
Comment alanyl-tRNA synthetase [Desulfurococcus fermentans DSM 16532]
Sequence
MSKNISFDYLRKYGYEKYTCKRCEEGVLWSRIPRDTCPDRPCSKYEFLYKDYKRVRPLSL
QEVREKFIGFLKSKGHGVVDPYPVLARWRNDLYLTIASIVVFQPAVTDGIVDPPYNPLVI
IQPSIRLSDIDNVGLTFGRHLTSFEMGGMHAFNKPGKFVYWVEGILDNTIEFFNKEIGID
LDDLVFKEGWWEGGGNAGPAPEVLVDGMELATLVHMMYKVVDGKYVENPVLVVDCGYGIE
RIAWFTQKTPTGFHAIYGRLVNEYKDVLGVEEPSYDVLKKAVYLLSDKEIGSIHEYERLL
RELGFGDYVDEFVKTIYLYSALDHARTISLMLSDGVVPSNTGEGYLARLVIRRLLRNLAR
LGVEPGRLTDVVQELLDRQVKYWKNDYIYGKFEKHRDYILDVVTMETSKFIDAVSRGIDI
VDKLLKKKRELLLEDLVTIYDSHGIPPEFVAERAREHGVKVEIPGDFYSRIAQRHSSPGV
LVKEKEHEFPEDVVKWASGFPATYRVFHENPYLTSVNAKVLGVRGKYFILDRTVMYPWAG
GQDHDTGFIEVNGRGYEVEYVGKVGDVIIHVLKEPVEINENTMIRVVIDWYRRYRLMKHH
TATHIILAAARYILGDHVWQAGAEKTIEKARLDITHHKSLTSEDVRKIEELANRIIEDRV
DLRFHYTGKFEAENKYGLKIYQGGAIYSPILRIVEIPGWDAQACFGTHVFNTSEVGGVKI
INAERIQDGVIRLEFIASTRLVDKIRLLESEIGEALSILGSKQGDLASAVKKIKREYDKT
LEVLEKYRDLMGKTIISKALTEEISICGIDTVYVELPISDEKLVKQVLEELSLKHGVLTT
IDTGELIEIAVKPEKAVEKNIDLRRITEELTGKGIKGGGKPDHVTLRKTRDIKKEEVMNA
LKNILCRQ
Download sequence
Identical sequences I3XT11
WP_014767980.1.2099 gi|390938922|ref|YP_006402660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]