SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390938993|ref|YP_006402731.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938993|ref|YP_006402731.1|
Domain Number 1 Region: 4-153,193-395
Classification Level Classification E-value
Superfamily Translation proteins 3.36e-72
Family Ribosomal protein L3 0.00000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390938993|ref|YP_006402731.1|
Sequence length 396
Comment 50S ribosomal protein L3 [Desulfurococcus fermentans DSM 16532]
Sequence
MGHRKLHAPRHGSLGVRPRKRAEELTPRVKRWPEKSWFDILVERLGNEATSQGVVARPVL
LGFPVYKAGMTHAIIVEDRPNTPVTGKEVFTPVTILDAPPIVVLGVRTYIIDEEGYLKTK
GEAWRSPHDAVAKAFEELYAGIPLMGISVKDVVRKYLHGLRKVNHGLVKPEPSSEYGFKF
VAESSESELRDALSGEIADVRVIASTIPVLSGIGKKKPEIIELKIGGGSIDERLKYAEGI
LGGYVKASDVFMEGQFVDVIGVTKGKGFQGVVKRFGVKELPRWHKHRKGSRKIGARSPGF
GTMSEPPQAGQMGFHRRTEYNKRILKMGLNGLETTIEGGFLHYGLVYGPYIMLKGTVFGP
AKRMLILRHPIRPNLRWLPLSGPKIAYLSLESKQGI
Download sequence
Identical sequences I3XT82
gi|390938993|ref|YP_006402731.1| WP_014768048.1.2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]