SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390939008|ref|YP_006402746.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390939008|ref|YP_006402746.1|
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 2.21e-16
Family Putative zinc binding domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390939008|ref|YP_006402746.1|
Sequence length 119
Comment hypothetical protein Desfe_1303 [Desulfurococcus fermentans DSM 16532]
Sequence
MGRRRKRRKIIKKAVRIPVLFQCPNCGSHTLSVTFRREDSGRKAIISCSRCGLYYEYNNV
PSIYQSVDVYNKFIDLFEEGKISVEFKPVIGAGEEISGEEIVEELEELGEEIGEERDEE
Download sequence
Identical sequences I3XT97
gi|390939008|ref|YP_006402746.1| WP_014768063.1.2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]