SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390939050|ref|YP_006402788.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390939050|ref|YP_006402788.1|
Domain Number 1 Region: 1-75,165-336
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.12e-70
Family Pyruvate kinase 0.0000551
Further Details:      
 
Domain Number 2 Region: 70-163
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.00000000000000767
Family Pyruvate kinase beta-barrel domain 0.0027
Further Details:      
 
Domain Number 3 Region: 320-461
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 0.0000000000000824
Family Pyruvate kinase, C-terminal domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390939050|ref|YP_006402788.1|
Sequence length 473
Comment pyruvate kinase [Desulfurococcus fermentans DSM 16532]
Sequence
MGKVKIIATLGPSSRDYNVIRKMIKEGVAGFRINCAHGDENTWIEYVKLVRDASSDLGKA
IPLILDTPGPQVRSGDFQEFTVKQGDNVVISSNPGNDGGEKKIIIVPAKEFYTAASTGDI
ILYGDGEISFRVVNTGEDFVEVVVLNDGVVKPRKKVVIEGKEYPVAFPSEVDRRVFKFAG
DVKATFVALSYVRSLKDVELAKDVLSRHGWMPGLIAKIETRSGFINMGEIIEVVDGVIVA
RGDLGLHFPLEKLPLIQKEIVREAIKHGKTVIIATEILESMVNNPRPSRSDVVDLYNSVG
DLVDAVLFTNETAIGKYPVEVVRWTRRIIEAAESELSRALISEYRGAIKAMNLLDKYVQG
LVLLAESLGGTIVGYSKTGRMPTLVSKYRPQIKVYIGVSNRFLAEKLSIKYGLEITDMSQ
AIQDNLEKEYEVGVEKLVETLVKQNYLRPGDIVVETYAKPQTSIHEIRIRQII
Download sequence
Identical sequences I3XTD9
WP_014768104.1.2099 gi|390939050|ref|YP_006402788.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]