SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390939054|ref|YP_006402792.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|390939054|ref|YP_006402792.1|
Domain Number - Region: 5-41
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0034
Family Transcriptional factor domain 0.067
Further Details:      
 
Domain Number - Region: 57-88
Classification Level Classification E-value
Superfamily beta-catenin-interacting protein ICAT 0.00471
Family beta-catenin-interacting protein ICAT 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390939054|ref|YP_006402792.1|
Sequence length 96
Comment DNA-directed RNA polymerase, M/15 kDa subunit [Desulfurococcus fermentans DSM 16532]
Sequence
MVKLCPRCGSPLMPVKKDGETVLKCNKCGYEVRTDKRREKYSVKYQVDASKRVVTAQATE
TKETKLSPEEREILSEYYEVLLEELEREEGSSEESD
Download sequence
Identical sequences I3XTE3
WP_014768108.1.2099 gi|390939054|ref|YP_006402792.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]