SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390939123|ref|YP_006402861.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390939123|ref|YP_006402861.1|
Domain Number 1 Region: 79-152
Classification Level Classification E-value
Superfamily Hypothetical protein AF0491, middle domain 2.62e-23
Family Hypothetical protein AF0491, middle domain 0.00022
Further Details:      
 
Domain Number 2 Region: 3-84
Classification Level Classification E-value
Superfamily FYSH domain 3.92e-22
Family Hypothetical protein AF0491, N-terminal domain 0.00034
Further Details:      
 
Domain Number 3 Region: 154-226
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 7.67e-19
Family Hypothetical protein AF0491, C-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390939123|ref|YP_006402861.1|
Sequence length 231
Comment Ribosome maturation protein SBDS [Desulfurococcus fermentans DSM 16532]
Sequence
MKDKLVIARYEAKGYRFEILVDPELALKIKEGKQVSIDEVVAGDFIYKDARKGLKASPES
MKEVFGTDDPKVVAVEIIKRGELQLTAEQRRKFIEEKRAQILNLIARNAIDPKTKLPIPV
KRLELAMEQARISIDPYKPAEQQMEHIVSQLAKVIPIKIAKAYVAVRIPSEYASRSLKQI
QVMGTTKKTQWREDGSLYMELEIPAGLQQELIDKVNALTKGSGEVKILNVG
Download sequence
Identical sequences I3XTL2
WP_014768173.1.2099 gi|390939123|ref|YP_006402861.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]