SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390939145|ref|YP_006402883.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390939145|ref|YP_006402883.1|
Domain Number 1 Region: 5-212
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.47e-47
Family G proteins 0.000000448
Further Details:      
 
Domain Number 2 Region: 204-319
Classification Level Classification E-value
Superfamily Translation proteins 7.95e-32
Family Elongation factors 0.000022
Further Details:      
 
Domain Number 3 Region: 327-414
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 4.41e-25
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390939145|ref|YP_006402883.1|
Sequence length 418
Comment small GTP-binding protein [Desulfurococcus fermentans DSM 16532]
Sequence
MPWDIKPPEVNIGVVGHVDHGKTTLVQALTGVWTAKHSLEIERGMTIKLGYADGNIAYCD
GLPLPDAYTIKEYCPDGSESKLLRRVSYVDAPGHELYMTTMLSGAMIMDGAILVIAANEP
CPQPQTVEHLMALNILGLRNIIIVQNKIDVVDKKRALENYNEILKLVKGTVAENAPIIPV
SALHHINIDALLQAIQEIIPTPERDYTKPPLMYVVRSFDVNKPGTPYDKIEGGVIGGSLL
QGRFRVGDEIMILPGIKTQVGSAKSQVSKYEPIVTTIEEIRYGNLIVDEARPGGLVAIQT
KLDPSLTKGDQLVGSIVTTPRNNIPVVKTLEVRFQLFERIVGTKELGKLPPIQVNEKIAV
AIGTANRVAVVKSIRKDIMTIELTDPVATWSGSRIAISRRVLARWRLAGWGIIEGVSE
Download sequence
Identical sequences I3XTN4
gi|390939145|ref|YP_006402883.1| WP_014768195.1.2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]