SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390939165|ref|YP_006402903.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390939165|ref|YP_006402903.1|
Domain Number 1 Region: 4-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.82e-77
Family G proteins 0.0000000741
Further Details:      
 
Domain Number 2 Region: 326-430
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 3.09e-40
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000265
Further Details:      
 
Domain Number 3 Region: 232-322
Classification Level Classification E-value
Superfamily Translation proteins 2.08e-28
Family Elongation factors 0.00000915
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390939165|ref|YP_006402903.1|
Sequence length 438
Comment translation elongation factor EF-1 subunit alpha [Desulfurococcus fermentans DSM 16532]
Sequence
MSAPQKPHLNIVIIGHVDHGKSTMTGHILYRLGYFDEKSVKMIEEEAKKMGKESFKFAWL
LDRMKEERERGVTISLSYMKFETKKYFFTIIDAPGHRDFVKNMITGASQADAAILVVSAR
KGEFEAGMSAEGQTREHAILARTMGINQLIVAINKMDATEPPYSEKRYNEIKEILGKFLK
GLGYDISKIPFIPVSAWTGENLIERSPNMPWYNGPTLVEALDLLTVPPKPLDKPLRIPIQ
DVYSISGVGVVPVGRVETGVLKVGDKVVFMPPGLIGEVKSIETHHSKIEKAEPGDNIGFN
VKGIEKKDVKRGDVAGSLDVPPTVADEFTARIMIMWHPTAIAVGYTPVIHVHTASVACRI
TEIISKIDPRTGKEVEKNPQFLKQGDIAIVKFKPIKPLVVEKYADFPALGRFAMRDMGKT
IGIGQVLEIKPAQVNIKK
Download sequence
Identical sequences I3XTQ4
WP_014768215.1.2099 gi|390939165|ref|YP_006402903.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]