SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390937873|ref|YP_006401611.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|390937873|ref|YP_006401611.1|
Domain Number - Region: 455-537
Classification Level Classification E-value
Superfamily Prefoldin 0.0288
Family Prefoldin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390937873|ref|YP_006401611.1|
Sequence length 664
Comment hypothetical protein Desfe_0123 [Desulfurococcus fermentans DSM 16532]
Sequence
MNLISDLSPVGSGINRCFKLSNYLGDTIVVTVIGVDIQPGSSPNSRRQPLYSAVVLRDGE
IIASFEDVELYRLLRLVLEYHVDIIAVDNVYELASSENELRRIFELLPGNVKVVQVTGPP
NDARDVNSVARELGIDKVIETPLKTAYINALAAYRGIGYEVRLFAEKTRIVVTKGRSVTQ
GGMSRDRFLRCIRAGIAQATKEIKRILDENKLDYDMVIKRSKGGLEKSVFIVYAPRESLY
GLIKPLKYKNVKIIIKPYASRKPIEPVSDQARKPVIVGVDPGMSIGVSVLTLDGEPVLIT
SMKSPDRDEIINLISRIGKPVVVATDVSKPPETVVKLASMLNAVLYVPEQDITIDEKNRI
AREYSEKYMVNIPDSHTRDALAAAVKAYNNYKATIEEVKSKLANVKKVDRYQLIAEIIKG
KPFSEVLEEYFKRSIPKNPPLVEEKMKPTTTPVCEKLNEKVNTLEALVRKLLDEIERKDL
YIKDLELELKLTRSRKPGIEDYERKISVLQNELEALRRKIEDKDNVIRELYEKLLQLEEH
VVKLGRGDLVMIPKVSTVRREGGLVNRGVYMEKVLDVSSELKNILTSGRGFIVSPVVAVD
PLKERIPVVKPEIIYDLGDYVIVEKEVIEKANELWRKIDELIELERHERILRMIEEYQRS
RKNS
Download sequence
Identical sequences I3XQ12
WP_014766941.1.2099 gi|390937873|ref|YP_006401611.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]