SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390938467|ref|YP_006402205.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938467|ref|YP_006402205.1|
Domain Number 1 Region: 10-192,321-403
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.83e-63
Family Bacterial dinuclear zinc exopeptidases 0.00063
Further Details:      
 
Domain Number 2 Region: 192-320
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00000000000000718
Family Bacterial exopeptidase dimerisation domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390938467|ref|YP_006402205.1|
Sequence length 410
Comment acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase [Desulfurococcus fermentans DSM 16532]
Sequence
MTISQIYEIAKKILVDSIKFPTVLGEAYEDMIDYYREQLSEYGIHVTIHRVPDEFLRKTL
PREFNPEKPRFILLARIGNGEKVLQFNGHYDVVSPGEGWEMPPFEPVVRDDLVYGRGATD
MKGGIASILTALISLVQERREPSVIIEVALVPDEEIGGRTGTGYLVNELGSRPDYVIIAE
PSGLDNMYIGHRGNVWGIIRVHGKQAHGSAPWLGDNAFEKMLVFAQEFLKRYRERVSSRK
SNYLYEDERAAYPTITPGGLLIAPGSINIVPGTAGFSIDRRLIVEERVEDVIGEIQELLG
QVSRELNIDSSFTLVESSPPAFTPPDNKYTQILGEIIRKNTGREPRKTICIGGLDLRYYT
IKGIPAVSYGPGEVGLAHKPNEHIRISDVVRVSKIYVDFAKRFEKIQVDT
Download sequence
Identical sequences I3XRQ6
gi|390938467|ref|YP_006402205.1| WP_014767530.1.2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]