SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBQ68321 from Sporisorium reilianum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBQ68321
Domain Number 1 Region: 17-130
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-31
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 159-228,272-312
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000471
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CBQ68321
Sequence length 452
Comment pep:novel chromosome:GCA_000230245.1:10:176597:177955:-1 gene:sr14633 transcript:CBQ68321 description:"related to Neural Wiskott-Aldrich syndrome protein"
Sequence
MPSSSTISSSDKSKVKSAIPSSSNKIITATVGRVYAAHPSPSQWSYTGVEGAIAFVRDLV
KATFYFKVVDLKGTRGVIWEHEFYDGFQYNQDRTFFHSFEGDQCLIGFSFADEGEANDLF
KKVNNRSKYAKSKSSSSTTKKKKAASGGKIDKSMIGAPSGFKHVAHMGFSAEHGFSSENV
DPTWQALLEQLGSLGISEKDIRQNESFIKDFVGKRGGPGAAAAKRAPPAAPKAKKVPPPA
PTSKRKAPPPPPAPRSRHTATASTASASSVAPPPPPPPPRSGAGASAVAPPPPPPPPMRA
PAGSSAPPPPPPPMRPAAGGGAPPPPPPPPPMGGSGAPPPPPPPPPAAGGSAPLPPPQDG
RGALLASIQGKSVHNLKKTDASAPPPPGRAAVAGGIAGAAAGAGAAAAVASGSDSPGAGA
GDGDLASALAAALSQRKENMGDSDEEGSDDDW
Download sequence
Identical sequences E6ZM64
CBQ68321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]