SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBQ73046 from Sporisorium reilianum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBQ73046
Domain Number 1 Region: 410-541
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000031
Family UBX domain 0.016
Further Details:      
 
Domain Number 2 Region: 216-306
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000246
Family Thioltransferase 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CBQ73046
Sequence length 576
Comment pep:novel chromosome:GCA_000230245.1:6:524021:525751:1 gene:sr13710 transcript:CBQ73046 description:"conserved hypothetical protein"
Sequence
MATQRSGSQQDAIASLRSVLQSSGNSAPDDEILATLLEVEGWDVTRAARLVEEDTTAERR
RSGADDETIARSFAQDPRIRGSMDFDQSMTYDTSRRQTFDNGTGAPSGRPGGAGLRPYSR
AADNSGSMGVAQMIWTALTFPLSLASSLLLFLARILRIRALFPSLFGGGTASRSLGRSDP
HTCAETFVRELEEQTGATTSRSVVHTQDSGSRAPPPKRLPPFFVGGYADALRAAKEQIKI
LAIVLVSREHGDVDRFKQNTLTDSDLVELLSRDDFIVWGGDVREREAYQVATTLQASTYP
FVAFIALQPSRSASRGSASSSSSSPRAAVLSRLEGSPASVTSAATIASHISDILLPRTRT
YLDRLRAEKRRREMERQLRAEQDRAYQEASRRDAERITQRREQERLKALEAQRLREEQEQ
QEQLQRKRQAWQKWALDHLVPAEPSSSSESVRLSFRLPSGKTLIRRFAPTHTVAAVFAFV
EASSISAEGGGSSQKPEGYEHEYRFSLVTGYPRKRIEMVELGGQQLKDVEGLAKGASLIV
EGSVMGDQQAATDDETDEDDEDDDENHAGSGVSKSP
Download sequence
Identical sequences E7A0N9
CBQ73046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]