SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339443703|ref|YP_004709707.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339443703|ref|YP_004709707.1|
Domain Number 1 Region: 5-113
Classification Level Classification E-value
Superfamily Cell growth inhibitor/plasmid maintenance toxic component 1.32e-33
Family Kid/PemK 0.0000611
Further Details:      
 
Weak hits

Sequence:  gi|339443703|ref|YP_004709707.1|
Domain Number - Region: 124-159
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0278
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339443703|ref|YP_004709707.1|
Sequence length 170
Comment hypothetical protein EGYY_00230 [Eggerthella sp. YY7918]
Sequence
MSERPRRGDVFLAFLDPVIGCEQGGTRPVLIVQNDAGNKRSRTVIVAAITSKPKRGLPTH
VPVPAVAGLREKSVVLLEQLKTIDKARLRAYIGHMGQSQMEKVDSALAVSLGIKGARDGF
MLLTLCRKCHQAFCDSGDYLVYRSDFRQEEREPCTICNTRTGYDYKVVKR
Download sequence
Identical sequences F7UX48
gi|339443703|ref|YP_004709707.1| WP_013978556.1.69488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]