SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339443845|ref|YP_004709849.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339443845|ref|YP_004709849.1|
Domain Number 1 Region: 59-438
Classification Level Classification E-value
Superfamily Multiheme cytochromes 6.18e-89
Family Di-heme elbow motif 0.0000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339443845|ref|YP_004709849.1|
Sequence length 439
Comment formate-dependent nitrite reductase [Eggerthella sp. YY7918]
Sequence
MTKVKRNKAALWTASLCAFGLVMGLVACAPQNSSESTDQKADEKAQVETPATDEYGVVKA
ASWATIYPEECETYMMNASNSPDSGKHNYLELYPALNTMYKGYAFALGYDEASSHLYTLQ
SVKETPRTTQKEQLANCITCKTPQFTRLVETEGDGVYAQKFNDTIGQFDENISCYNCHEN
DPETLNVTGQYFVKSLGNAANDDAAVPMAAQVCGQCHNEYYFDPETKVTSNPYVGLEAMT
PDAILAYYDEMGFSDWNHKDTFAPMIKVQHPEFETMYGGDKGPMAKNGYSCADCHMGKVN
EGTENEYTSHNWISPLENDQLLENDCSQCHNDLKAEVAKTQAKEEERVTAISEKIADMTN
KIAAKYADEIATLKAAKEAGEKPTPSAELAALQKLQRNAQFYWDFVMVENSEGAHNPTLT
FETLDKAEAAADEALAMLA
Download sequence
Identical sequences F7UXJ0
WP_013978698.1.69488 gi|339443845|ref|YP_004709849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]