SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339443846|ref|YP_004709850.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339443846|ref|YP_004709850.1|
Domain Number 1 Region: 45-232
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00000000000335
Family Di-heme elbow motif 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339443846|ref|YP_004709850.1|
Sequence length 246
Comment hypothetical protein EGYY_02100 [Eggerthella sp. YY7918]
Sequence
MSEEEVKVEAATEAAASDEPITEEAAPKKKGKKKWPIIVGVVAVVVIAAGAGFWVWHEQP
SFCNAICHTPMDPYLPTYEAEPGQPAVDKWGNEVENASSMMAALHRVSKDQGGADATCLS
CHVPDIGEQMTEGMNWISGNYVNPLEERDLEQLVEARGVEKDEFCLNEACHVKDDGSVMT
RDDLIAATEDMGEYNPHVAQHGKIDCSECHKGHRASVVYCTQCHSEAEVPEGWLTVQEAN
KLASAA
Download sequence
Identical sequences F7UXJ1
gi|339443846|ref|YP_004709850.1| WP_013978699.1.69488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]