SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339444003|ref|YP_004710007.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339444003|ref|YP_004710007.1|
Domain Number 1 Region: 33-108
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00000122
Family Di-heme elbow motif 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339444003|ref|YP_004710007.1|
Sequence length 109
Comment hypothetical protein EGYY_03830 [Eggerthella sp. YY7918]
Sequence
MKKVLILAFTLVLALGMLAVFGCSPHKTTEEEVATTTNGEPPVIPSDHVGRYDGNGSTDC
YQCHGSDGKNNPSLSTSVALPENHYKDGNVDSLELDPLREQCILCHAQS
Download sequence
Identical sequences F7UYF6
gi|339444003|ref|YP_004710007.1| WP_013978856.1.69488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]