SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339444455|ref|YP_004710459.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339444455|ref|YP_004710459.1|
Domain Number 1 Region: 44-178
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000000000000306
Family Di-heme elbow motif 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339444455|ref|YP_004710459.1|
Sequence length 199
Comment hypothetical protein EGYY_08660 [Eggerthella sp. YY7918]
Sequence
MTDTQTTIPGQTKEAAPTKRMRRPKKPAIIVSILFVVIAAGAVGFGIWHEQPSFCNAICH
SPMDTYYESYDEGTGMARIHKEAHVTCLDCHETSFGQQLSEAWTWVIGDFSEPLDMMNYD
DSTCLTCHISEEFQAAKTDLIEFNPHADAHQALACTDCHKSHNEQVNYCSNCHDNGGQRM
ITWPLEGHQIPEAEEKEAS
Download sequence
Identical sequences F7UZW5
gi|339444455|ref|YP_004710459.1| WP_013979308.1.69488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]