SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339444571|ref|YP_004710575.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339444571|ref|YP_004710575.1|
Domain Number 1 Region: 396-475
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000424
Family Cadherin 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339444571|ref|YP_004710575.1|
Sequence length 525
Comment hypothetical protein EGYY_09920 [Eggerthella sp. YY7918]
Sequence
MSGTKLAAGLTGLLLTGACAICALCAAPSVAEAATVGDLTIVRTADGSDPIPGVDYEYDD
FSRSLNILSNTPMTISGSTTEDCIGVEHYTDANLTFENLTIDVQMPAYFSAVALGSTAAD
GDCSLTLTVVGDNLLRTQFGNGIFVPSYSELTISDASTGKLEVYGEPGDRTNPTPGRAAL
GGSNNGPITINGGTIIAHGGNSSAGIGGNARGNGQDITINGGNVTATSAGSAAGIGGGGV
YSFAYRIAINGGVVHATGGMMGAGIGSGAIGEADGITITGGEVYAYGGSLGAAGIGGGTL
GNLANFKVTGGTIHAEGSIDPDYGEAAGIGSGVSSRGGSSGNAVEPPAGYSALIEGILGG
GTVLATAAQPYMFDETDRVADITFAPQLAVDGRALPQAQVGSAYQATLNAVGGASPYTWT
VATGTLPDGLVLDPSTGIITGTPTQAGTATFTVTATDAWGVSASTEKTILVTPPQSSNDG
IDSKKMALANTGDGGLAGTSAGLIGLVAVAIALVGLSVAQRKTRH
Download sequence
Identical sequences F7V081
gi|339444571|ref|YP_004710575.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]