SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339445173|ref|YP_004711177.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339445173|ref|YP_004711177.1|
Domain Number 1 Region: 48-92,158-193
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000000000000315
Family Di-heme elbow motif 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339445173|ref|YP_004711177.1|
Sequence length 193
Comment hypothetical protein EGYY_16360 [Eggerthella sp. YY7918]
Sequence
MTLSAAGFTFCLFVALALVGCQSTPSDRALMPGIAAAEQISPQDWKWSPDQECAPCHSIE
AHTAAASACTDFSDASSSCLTCHNVEQELTVAHEDIRNVKPVSDLQQVTVEKEVCTRCHT
IASLAERTADSVALADNNGVTINPHALLKTKGHSEIDCTACHTMHESSDRLETSSKMCRE
CHHADSFECESCH
Download sequence
Identical sequences F7UUA3
gi|339445173|ref|YP_004711177.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]