SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339445234|ref|YP_004711238.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339445234|ref|YP_004711238.1|
Domain Number 1 Region: 106-210
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000000000031
Family Di-heme elbow motif 0.0052
Further Details:      
 
Weak hits

Sequence:  gi|339445234|ref|YP_004711238.1|
Domain Number - Region: 68-114
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00136
Family Cytochrome c3-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339445234|ref|YP_004711238.1|
Sequence length 223
Comment hypothetical protein EGYY_16970 [Eggerthella sp. YY7918]
Sequence
MDEMREKDVREDRFGGAGQSAQETAQKSAPAAAHAPAGAPKRRAKRWPLVVSVVAIVLVA
AGAGFWVWHEQPSFCNAICHDPMDAYVEGYFNDATLMANAHEREDVSCLQCHEAKIDEQV
TEALSWVRGDFATDETGHLTTQGVTADSKMCATEGCHNFDEVIAMTDNWGGEEGVNPHRS
HQGIAIDCSNCHGGHTTSYMYCNACHDYETPDGWLNPSKGGRA
Download sequence
Identical sequences F7UUG4
WP_013980081.1.69488 gi|339445234|ref|YP_004711238.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]