SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339445400|ref|YP_004711404.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|339445400|ref|YP_004711404.1|
Domain Number - Region: 89-139
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000335
Family Cytochrome c3-like 0.05
Further Details:      
 
Domain Number - Region: 17-79
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00732
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339445400|ref|YP_004711404.1|
Sequence length 184
Comment adenylate cyclase, family 3 [Eggerthella sp. YY7918]
Sequence
MNELLSQLWTPELQAAFSVVMVLLVILYVLSIVWVVRDAYLRGSYWYVWGVVALVPLLGV
IAYCLLRPPLLQIDRDEQELEVALKQRELMKYGECANCGYPVEADYVLCPNCHQRLKNLC
GTCNHALDPTWTVCPYCATPVTSSPRGGRRAAVQRGRTPQPQQQAAPQQQARRARAAQGE
EPLS
Download sequence
Identical sequences F7UUY0
gi|339445400|ref|YP_004711404.1| WP_013980247.1.69488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]