SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339445543|ref|YP_004711547.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|339445543|ref|YP_004711547.1|
Domain Number - Region: 12-76
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0138
Family Di-heme elbow motif 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339445543|ref|YP_004711547.1|
Sequence length 144
Comment hypothetical protein EGYY_20560 [Eggerthella sp. YY7918]
Sequence
MDREALAARALELHGCNCNCAQSVACSLAPFVGADEDVCFHAAEGFGAGMGGLTETCGAL
SGGIMILGFAMSNGIDEPTNKAATYRLVRQLLERFREQNGSTTCADLKGATTGTPLRSCN
GCIEDALAITADLLEEHHLATCST
Download sequence
Identical sequences F7UVC3
WP_013980390.1.69488 gi|339445543|ref|YP_004711547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]