SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339446322|ref|YP_004712326.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339446322|ref|YP_004712326.1|
Domain Number 1 Region: 83-259
Classification Level Classification E-value
Superfamily Sortase 5.76e-23
Family Sortase 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339446322|ref|YP_004712326.1|
Sequence length 263
Comment hypothetical protein EGYY_29610 [Eggerthella sp. YY7918]
Sequence
MSEADHKRPRRRAAGWLLAGILLLALCGAMAAFQASTAGSAASVVPNPRGQPFGSLSAAA
VSAMASNESPTAADAEGVDWDYWRVVNPAIVAWVSVDGTAIDYAVVQAPGGDPDYYLSHD
IYRSWNPYGCPYVDAACDGVGGMSAVVFGHNMGGGFVAMFADFARYSDEAFARSHPTIEL
QTPNGAMELSVSAVDVIDGSENAKRTDFSSADEMRAWYAQRFEECDVRISNDENASQLFT
FVTCSYTTYANERTLVYAQPAES
Download sequence
Identical sequences A0A1Y4FS82 A0A1Y4G3P9 F0HQ40 F7UYH5 S6CB91
gi|550889347|ref|YP_008663439.1| WP_009305538.1.47064 WP_009305538.1.64493 WP_009305538.1.69488 WP_009305538.1.74853 WP_009305538.1.87052 WP_009305538.1.95410 gi|339446322|ref|YP_004712326.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]