SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|431932456|ref|YP_007245502.1| from Thioflavicoccus mobilis 8321

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431932456|ref|YP_007245502.1|
Domain Number 1 Region: 37-90
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000156
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|431932456|ref|YP_007245502.1|
Sequence length 120
Comment Kunitz/bovine pancreatic trypsin inhibitor-like protein [Thioflavicoccus mobilis 8321]
Sequence
MSLMSFPKILPFLFIAALVGACETPSPTTEQNHDLLPVRCIDEADLDACPGDSTGYYYDY
RDNSCKPFRYGNCQVKVPFDTRDECIQVCVASGSTGAPDKRTDPVSDPHPAIADSPFAIE
Download sequence
Identical sequences L0H1D9
gi|431932456|ref|YP_007245502.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]