SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386337411|ref|YP_006033580.1| from Streptococcus gallolyticus subsp. gallolyticus ATCC 43143

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386337411|ref|YP_006033580.1|
Domain Number 1 Region: 42-431
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.08e-94
Family Amylase, catalytic domain 0.00000000118
Further Details:      
 
Domain Number 2 Region: 605-708
Classification Level Classification E-value
Superfamily Starch-binding domain-like 2.21e-32
Family Starch-binding domain 0.0000503
Further Details:      
 
Domain Number 3 Region: 434-520
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.15e-22
Family alpha-Amylases, C-terminal beta-sheet domain 0.00012
Further Details:      
 
Domain Number 4 Region: 524-599
Classification Level Classification E-value
Superfamily E set domains 5.32e-16
Family E-set domains of sugar-utilizing enzymes 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386337411|ref|YP_006033580.1|
Sequence length 710
Comment extracellular alpha amylase [Streptococcus gallolyticus subsp. gallolyticus ATCC 43143]
Sequence
MKKRILKFCLGAATLTALMTVPFSQNIVSAESYNSVSNKADFSSDVIYQIITDRFYDGDT
TNNPTGDIFDQSNLRKYHGGDWKGIIEKIEDGYLTELGITAIWISSPVENITTLDPTSNS
ASYHGYWARDFFNTNSAFGSQDDFKELVSVAHQNNIKVVIDFAPNHTSTAEYTGYTFPED
GSLYKNGNLVGSFSNDVNNIFNHESWTDYSTYENGIYHSLYGLADLNNLNPTVDNYLKEA
IDTWIDYGIDGIRVDAVKHMSLGWQKNWLSHIYENTGLFVFGEWYTGDTAAEEDMTSFAN
DSGMSLLDFRFANAIRNLYSNSAYTMQDFYNVLKATESDYEEVNDQVTFIDNHDMSRFST
LVNNNQSAVNQAYALLLTSRGVPTIYYGSEQYDEGTSDPDNRADISSFNQSTIAYQVISK
LTNIRKNNQALAYGSTEERWINSDVLIFERKFGSSVALIAVNKGSSSYHIDNLYSSLPSG
SYDDQLDSLLSSESISVDNNGVVSSFELDGGEVGVWVYNGDTDTVTIGDVDPSIGIVGNE
VTITGSGFGNNTGQVSFGSTVATVTSWSDSLIKVKIPTVSAGDYDITVTGSNGSEDTFSG
FEVLTSSQIPVRFIVNSAETSYGENVYIVGNVSELGNWDPDKAIGVFFNSTATIAQYPSW
FYDINIPANTQIEYKFIKKNQAGEVVWESGENHTLTTGTTAMTTQVDWQN
Download sequence
Identical sequences F5X010
gi|288904962|ref|YP_003430184.1| WP_012961739.1.19369 WP_012961739.1.4451 WP_012961739.1.57133 WP_012961739.1.76930 WP_012961739.1.8633 WP_012961739.1.89533 gi|386337411|ref|YP_006033580.1| gi|325977930|ref|YP_004287646.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]