SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384519463|ref|YP_005706768.1| from Enterococcus faecalis 62

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384519463|ref|YP_005706768.1|
Domain Number 1 Region: 278-449
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 1.44e-47
Family MgtE membrane domain-like 0.0000418
Further Details:      
 
Domain Number 2 Region: 137-259
Classification Level Classification E-value
Superfamily CBS-domain pair 1.64e-30
Family CBS-domain pair 0.000000353
Further Details:      
 
Domain Number 3 Region: 7-135
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 3.01e-28
Family MgtE N-terminal domain-like 0.000000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384519463|ref|YP_005706768.1|
Sequence length 453
Comment mgtE gene product [Enterococcus faecalis 62]
Sequence
MNEGQEMEEQFALLLETLKNQQMNEFRELFLALHIYEQGQFYQSLDEKDRQHLYNYLSPK
ELADMFDVIEEDNENMKDYLAEMRPSYAADMLAEMYTDNAVDLLNMLDKSQKAKYLSLLS
SEEAGEIKELLHYEDETAGAIMTTEFVSIVANQTVRSAMYVLKNQADMAETIYYVYVVDQ
ENHLVGVISLRDLIVNDDDTLIADILNERVISVHVGDDQEDVAQTIRDYDFLAVPVTDYD
DHLLGIVTVDDIIDVIDDEAASDYSGLAGVDVEEVSENPLKAASKRLPWLITLLFLGMST
ASLISNYESLVSEASILAVFISLITGTAGNAGTQSLAVAVRRLAMKDEKDSNFGRLILSE
VLTGLVTGAVTGLTIMIVVGVWQHNLPLGFVIGMAMLCAITVANLAGSLIPMLMDKLGFD
PAVASGPFITTLSDLTSVLIYFNIASMFMRYFV
Download sequence
Identical sequences A0A059N501 A0A0E9EEI7 A0A0M2A976 A0A0M2AQD6 A0A0M2CIU5 A0A0U1AMR0 A0A0Y4CEX4 A0A0Y7HVF3 A0A125W2N9 A0A1B4XQX6 A0A1R4KTK3 C0X7U4 C7VB45 C7WZH6 D4EI25 D4EWG8 E0HAM5 E2YEP8 E2YP16 E2YS98 E6EUN9 E6GMA6 E6GXS3 E6H6K8 E6IAG6 J5E2B1 J6A3E1 J6AUA1 J6CFV3 J6CLJ7 J6DW40 J6DYL5 J6EGW4 J6EK81 J6M772 J6NBY0 J6PU93 J6QIY7 J6QZ57 J6RHE4 J6RJI0 Q830V1 R3GTH9 R3I1E7 S4C5U3 U6S4C7 V7ZLA7 X5NYB5
NP_816305.1.90627 WP_002362548.1.100343 WP_002362548.1.100390 WP_002362548.1.100415 WP_002362548.1.10042 WP_002362548.1.100482 WP_002362548.1.101272 WP_002362548.1.101275 WP_002362548.1.101479 WP_002362548.1.101808 WP_002362548.1.101818 WP_002362548.1.101914 WP_002362548.1.102128 WP_002362548.1.10330 WP_002362548.1.10696 WP_002362548.1.10758 WP_002362548.1.11048 WP_002362548.1.11193 WP_002362548.1.11284 WP_002362548.1.11459 WP_002362548.1.11651 WP_002362548.1.11776 WP_002362548.1.12145 WP_002362548.1.12235 WP_002362548.1.12247 WP_002362548.1.12449 WP_002362548.1.12625 WP_002362548.1.12630 WP_002362548.1.12825 WP_002362548.1.12889 WP_002362548.1.1291 WP_002362548.1.12926 WP_002362548.1.13365 WP_002362548.1.13369 WP_002362548.1.1344 WP_002362548.1.13739 WP_002362548.1.14157 WP_002362548.1.14180 WP_002362548.1.14269 WP_002362548.1.14402 WP_002362548.1.14420 WP_002362548.1.14485 WP_002362548.1.14750 WP_002362548.1.14792 WP_002362548.1.15224 WP_002362548.1.15286 WP_002362548.1.15458 WP_002362548.1.15543 WP_002362548.1.15705 WP_002362548.1.1595 WP_002362548.1.16241 WP_002362548.1.16763 WP_002362548.1.17164 WP_002362548.1.17287 WP_002362548.1.17682 WP_002362548.1.17799 WP_002362548.1.17800 WP_002362548.1.1799 WP_002362548.1.18048 WP_002362548.1.18259 WP_002362548.1.18260 WP_002362548.1.18390 WP_002362548.1.18475 WP_002362548.1.18524 WP_002362548.1.18709 WP_002362548.1.19115 WP_002362548.1.19165 WP_002362548.1.1948 WP_002362548.1.19601 WP_002362548.1.19675 WP_002362548.1.19734 WP_002362548.1.19902 WP_002362548.1.19951 WP_002362548.1.20029 WP_002362548.1.20348 WP_002362548.1.20659 WP_002362548.1.2067 WP_002362548.1.20674 WP_002362548.1.2171 WP_002362548.1.21993 WP_002362548.1.22059 WP_002362548.1.2207 WP_002362548.1.22780 WP_002362548.1.22796 WP_002362548.1.23017 WP_002362548.1.23054 WP_002362548.1.23319 WP_002362548.1.23322 WP_002362548.1.23498 WP_002362548.1.23569 WP_002362548.1.23904 WP_002362548.1.24023 WP_002362548.1.24064 WP_002362548.1.24526 WP_002362548.1.24581 WP_002362548.1.246 WP_002362548.1.2486 WP_002362548.1.25180 WP_002362548.1.25583 WP_002362548.1.25669 WP_002362548.1.25702 WP_002362548.1.25704 WP_002362548.1.25979 WP_002362548.1.26187 WP_002362548.1.26451 WP_002362548.1.27081 WP_002362548.1.27216 WP_002362548.1.274 WP_002362548.1.2799 WP_002362548.1.2801 WP_002362548.1.28038 WP_002362548.1.28185 WP_002362548.1.28221 WP_002362548.1.28428 WP_002362548.1.28487 WP_002362548.1.28579 WP_002362548.1.28817 WP_002362548.1.28932 WP_002362548.1.28980 WP_002362548.1.29097 WP_002362548.1.29627 WP_002362548.1.29985 WP_002362548.1.3016 WP_002362548.1.30275 WP_002362548.1.30586 WP_002362548.1.30609 WP_002362548.1.31324 WP_002362548.1.31326 WP_002362548.1.31656 WP_002362548.1.31869 WP_002362548.1.32099 WP_002362548.1.321 WP_002362548.1.32265 WP_002362548.1.32385 WP_002362548.1.32500 WP_002362548.1.33139 WP_002362548.1.33306 WP_002362548.1.33460 WP_002362548.1.33513 WP_002362548.1.33531 WP_002362548.1.33574 WP_002362548.1.33581 WP_002362548.1.33685 WP_002362548.1.33798 WP_002362548.1.33851 WP_002362548.1.34192 WP_002362548.1.34256 WP_002362548.1.34766 WP_002362548.1.34999 WP_002362548.1.35171 WP_002362548.1.35283 WP_002362548.1.35810 WP_002362548.1.35823 WP_002362548.1.36198 WP_002362548.1.36209 WP_002362548.1.36269 WP_002362548.1.3645 WP_002362548.1.36880 WP_002362548.1.36900 WP_002362548.1.37181 WP_002362548.1.37810 WP_002362548.1.37850 WP_002362548.1.37885 WP_002362548.1.37996 WP_002362548.1.38725 WP_002362548.1.38784 WP_002362548.1.3909 WP_002362548.1.39119 WP_002362548.1.39771 WP_002362548.1.39932 WP_002362548.1.4014 WP_002362548.1.40357 WP_002362548.1.4071 WP_002362548.1.40757 WP_002362548.1.40908 WP_002362548.1.41053 WP_002362548.1.41792 WP_002362548.1.41867 WP_002362548.1.42353 WP_002362548.1.42483 WP_002362548.1.42904 WP_002362548.1.42908 WP_002362548.1.43540 WP_002362548.1.43903 WP_002362548.1.43994 WP_002362548.1.44185 WP_002362548.1.44242 WP_002362548.1.44501 WP_002362548.1.44537 WP_002362548.1.44626 WP_002362548.1.45269 WP_002362548.1.455 WP_002362548.1.45643 WP_002362548.1.45860 WP_002362548.1.45925 WP_002362548.1.46056 WP_002362548.1.46113 WP_002362548.1.46346 WP_002362548.1.46348 WP_002362548.1.46357 WP_002362548.1.46363 WP_002362548.1.46448 WP_002362548.1.46606 WP_002362548.1.46621 WP_002362548.1.47172 WP_002362548.1.47217 WP_002362548.1.47225 WP_002362548.1.47407 WP_002362548.1.47539 WP_002362548.1.47856 WP_002362548.1.47867 WP_002362548.1.48063 WP_002362548.1.48126 WP_002362548.1.48153 WP_002362548.1.49131 WP_002362548.1.49392 WP_002362548.1.49646 WP_002362548.1.4975 WP_002362548.1.49914 WP_002362548.1.49961 WP_002362548.1.50067 WP_002362548.1.50115 WP_002362548.1.50160 WP_002362548.1.50513 WP_002362548.1.50810 WP_002362548.1.5083 WP_002362548.1.50938 WP_002362548.1.51046 WP_002362548.1.5113 WP_002362548.1.51694 WP_002362548.1.51712 WP_002362548.1.52575 WP_002362548.1.52614 WP_002362548.1.52639 WP_002362548.1.52926 WP_002362548.1.53279 WP_002362548.1.53342 WP_002362548.1.53631 WP_002362548.1.54277 WP_002362548.1.54634 WP_002362548.1.54652 WP_002362548.1.54795 WP_002362548.1.54934 WP_002362548.1.54998 WP_002362548.1.55065 WP_002362548.1.56483 WP_002362548.1.5680 WP_002362548.1.56974 WP_002362548.1.57048 WP_002362548.1.57136 WP_002362548.1.57163 WP_002362548.1.57211 WP_002362548.1.57242 WP_002362548.1.57302 WP_002362548.1.57542 WP_002362548.1.57671 WP_002362548.1.57705 WP_002362548.1.57758 WP_002362548.1.57968 WP_002362548.1.58089 WP_002362548.1.58620 WP_002362548.1.5872 WP_002362548.1.58766 WP_002362548.1.59454 WP_002362548.1.59564 WP_002362548.1.59645 WP_002362548.1.59658 WP_002362548.1.59690 WP_002362548.1.59698 WP_002362548.1.5994 WP_002362548.1.59964 WP_002362548.1.60200 WP_002362548.1.60220 WP_002362548.1.60361 WP_002362548.1.60394 WP_002362548.1.60422 WP_002362548.1.60579 WP_002362548.1.60776 WP_002362548.1.60940 WP_002362548.1.61083 WP_002362548.1.61089 WP_002362548.1.61103 WP_002362548.1.61180 WP_002362548.1.61290 WP_002362548.1.61503 WP_002362548.1.61932 WP_002362548.1.62847 WP_002362548.1.62949 WP_002362548.1.6312 WP_002362548.1.63148 WP_002362548.1.63158 WP_002362548.1.63477 WP_002362548.1.63507 WP_002362548.1.63579 WP_002362548.1.63848 WP_002362548.1.63884 WP_002362548.1.64022 WP_002362548.1.64483 WP_002362548.1.6473 WP_002362548.1.65210 WP_002362548.1.65397 WP_002362548.1.65461 WP_002362548.1.65563 WP_002362548.1.6626 WP_002362548.1.66308 WP_002362548.1.66316 WP_002362548.1.66390 WP_002362548.1.66403 WP_002362548.1.6682 WP_002362548.1.66843 WP_002362548.1.66845 WP_002362548.1.66898 WP_002362548.1.66902 WP_002362548.1.67436 WP_002362548.1.67615 WP_002362548.1.67683 WP_002362548.1.67716 WP_002362548.1.68409 WP_002362548.1.68828 WP_002362548.1.6893 WP_002362548.1.68935 WP_002362548.1.69290 WP_002362548.1.69336 WP_002362548.1.69521 WP_002362548.1.69648 WP_002362548.1.69824 WP_002362548.1.70043 WP_002362548.1.70675 WP_002362548.1.70756 WP_002362548.1.70799 WP_002362548.1.71303 WP_002362548.1.71406 WP_002362548.1.71499 WP_002362548.1.71510 WP_002362548.1.71725 WP_002362548.1.72058 WP_002362548.1.72077 WP_002362548.1.72635 WP_002362548.1.72733 WP_002362548.1.73695 WP_002362548.1.73817 WP_002362548.1.73824 WP_002362548.1.74362 WP_002362548.1.74389 WP_002362548.1.74591 WP_002362548.1.75211 WP_002362548.1.75297 WP_002362548.1.75486 WP_002362548.1.75949 WP_002362548.1.76074 WP_002362548.1.76128 WP_002362548.1.76541 WP_002362548.1.76646 WP_002362548.1.76958 WP_002362548.1.77327 WP_002362548.1.77328 WP_002362548.1.77357 WP_002362548.1.77956 WP_002362548.1.7815 WP_002362548.1.7819 WP_002362548.1.78447 WP_002362548.1.78471 WP_002362548.1.78503 WP_002362548.1.78641 WP_002362548.1.79457 WP_002362548.1.79791 WP_002362548.1.79975 WP_002362548.1.80104 WP_002362548.1.80396 WP_002362548.1.80452 WP_002362548.1.80556 WP_002362548.1.8058 WP_002362548.1.80867 WP_002362548.1.80889 WP_002362548.1.80976 WP_002362548.1.81312 WP_002362548.1.81327 WP_002362548.1.81459 WP_002362548.1.81575 WP_002362548.1.8179 WP_002362548.1.81880 WP_002362548.1.81991 WP_002362548.1.82160 WP_002362548.1.82202 WP_002362548.1.82555 WP_002362548.1.82993 WP_002362548.1.83032 WP_002362548.1.83327 WP_002362548.1.83490 WP_002362548.1.83649 WP_002362548.1.8380 WP_002362548.1.83953 WP_002362548.1.84260 WP_002362548.1.84380 WP_002362548.1.84469 WP_002362548.1.84573 WP_002362548.1.84632 WP_002362548.1.84813 WP_002362548.1.85162 WP_002362548.1.85355 WP_002362548.1.85465 WP_002362548.1.85534 WP_002362548.1.8575 WP_002362548.1.85848 WP_002362548.1.85862 WP_002362548.1.85945 WP_002362548.1.85963 WP_002362548.1.86134 WP_002362548.1.86666 WP_002362548.1.86904 WP_002362548.1.87000 WP_002362548.1.87252 WP_002362548.1.87277 WP_002362548.1.87385 WP_002362548.1.87482 WP_002362548.1.8794 WP_002362548.1.88329 WP_002362548.1.88464 WP_002362548.1.88661 WP_002362548.1.8901 WP_002362548.1.89060 WP_002362548.1.89088 WP_002362548.1.89321 WP_002362548.1.89431 WP_002362548.1.8960 WP_002362548.1.89791 WP_002362548.1.90047 WP_002362548.1.90100 WP_002362548.1.90371 WP_002362548.1.90503 WP_002362548.1.90642 WP_002362548.1.90872 WP_002362548.1.91092 WP_002362548.1.91394 WP_002362548.1.91555 WP_002362548.1.9159 WP_002362548.1.91608 WP_002362548.1.91813 WP_002362548.1.91925 WP_002362548.1.92037 WP_002362548.1.92073 WP_002362548.1.9214 WP_002362548.1.92348 WP_002362548.1.92581 WP_002362548.1.92820 WP_002362548.1.93159 WP_002362548.1.93277 WP_002362548.1.93642 WP_002362548.1.93977 WP_002362548.1.94041 WP_002362548.1.94399 WP_002362548.1.94506 WP_002362548.1.94630 WP_002362548.1.94964 WP_002362548.1.95143 WP_002362548.1.95212 WP_002362548.1.95228 WP_002362548.1.95340 WP_002362548.1.95445 WP_002362548.1.95493 WP_002362548.1.95534 WP_002362548.1.95629 WP_002362548.1.9570 WP_002362548.1.95935 WP_002362548.1.95970 WP_002362548.1.95971 WP_002362548.1.96320 WP_002362548.1.96467 WP_002362548.1.96481 WP_002362548.1.96745 WP_002362548.1.96764 WP_002362548.1.96987 WP_002362548.1.97078 WP_002362548.1.97268 WP_002362548.1.97643 WP_002362548.1.97828 WP_002362548.1.98078 WP_002362548.1.98122 WP_002362548.1.9842 WP_002362548.1.98652 WP_002362548.1.98840 WP_002362548.1.98868 WP_002362548.1.99 WP_002362548.1.99014 WP_002362548.1.99022 WP_002362548.1.9925 WP_002362548.1.99432 WP_002362548.1.99543 WP_002362548.1.99748 gi|384514002|ref|YP_005709095.1| gi|29377151|ref|NP_816305.1| gi|397700797|ref|YP_006538585.1| gi|428767818|ref|YP_007153929.1| NYSGXRC-10001b 226185.EF2668 gi|384519463|ref|YP_005706768.1| gi|479180815|ref|YP_007808124.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]