SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383329791|ref|YP_005355675.1| from Enterococcus faecium Aus0004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383329791|ref|YP_005355675.1|
Domain Number 1 Region: 278-449
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 1.44e-46
Family MgtE membrane domain-like 0.0000498
Further Details:      
 
Domain Number 2 Region: 137-270
Classification Level Classification E-value
Superfamily CBS-domain pair 1.39e-31
Family CBS-domain pair 0.000000689
Further Details:      
 
Domain Number 3 Region: 8-135
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 2.22e-29
Family MgtE N-terminal domain-like 0.00000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383329791|ref|YP_005355675.1|
Sequence length 453
Comment magnesium transporter [Enterococcus faecium Aus0004]
Sequence
MDENQELEERFAQLTQDLRENNIQAFRNSFLEMHIYEQGQFYQSLTEENRQLIYSYLSPK
ELADMFDVIEEDNEHMKEYLDEMRPSYAADMLSEMYTDNAVDLLNTLDKKQIAKYLSLMS
ADDASEIKELLHYEDETAGAIMTTEFVSIVANQTVRSAMYVLKNEADVAETIYYIYVVNQ
EGQLVGVISLRDLIVNDDDAMISDLMSERVLSVHVGDDQEDVAQTFRDYDFLALPVTDYD
DHLLGIVTVDDIIDVIDDEAASDYSGLAGVNVEEINENPVKAASRRLPWLITLLFLGMST
ASLISHYEDLVSEASILAVFISLITGTAGNAGTQSLAVAVRRLAISDEKDHGFVRLVLAE
VLTGVVTGAVTGITIFLIVGFWKHNFILGFVIGMAMLFAITVANLAGSLIPMLMDRLGFD
PAVASGPFITTLSDLTSVLIYFNIASLFMGYFM
Download sequence
Identical sequences A0A0M1XAU6 A0A0M1XXR0 A0A0M2ALV7 A0A0M2B1D2 A0A132Z3X8 A0A1A0GHU7 C9B7S6 C9BXU1 D4RID7 I3U4V0 J6Y119 S4E618 T4JRT5 U2NX11 U7TXA7
WP_002294561.1.100098 WP_002294561.1.100305 WP_002294561.1.100316 WP_002294561.1.100328 WP_002294561.1.10038 WP_002294561.1.100428 WP_002294561.1.100439 WP_002294561.1.100544 WP_002294561.1.10087 WP_002294561.1.101134 WP_002294561.1.101415 WP_002294561.1.101580 WP_002294561.1.1016 WP_002294561.1.101637 WP_002294561.1.101748 WP_002294561.1.101870 WP_002294561.1.102035 WP_002294561.1.102112 WP_002294561.1.10354 WP_002294561.1.10519 WP_002294561.1.10650 WP_002294561.1.10765 WP_002294561.1.10803 WP_002294561.1.11127 WP_002294561.1.11275 WP_002294561.1.11423 WP_002294561.1.11547 WP_002294561.1.11704 WP_002294561.1.11830 WP_002294561.1.11916 WP_002294561.1.12002 WP_002294561.1.12107 WP_002294561.1.1214 WP_002294561.1.12178 WP_002294561.1.12499 WP_002294561.1.12708 WP_002294561.1.13042 WP_002294561.1.13184 WP_002294561.1.13225 WP_002294561.1.13453 WP_002294561.1.13631 WP_002294561.1.13694 WP_002294561.1.13700 WP_002294561.1.13905 WP_002294561.1.14481 WP_002294561.1.1455 WP_002294561.1.14642 WP_002294561.1.14727 WP_002294561.1.14760 WP_002294561.1.14828 WP_002294561.1.15013 WP_002294561.1.15070 WP_002294561.1.15101 WP_002294561.1.15144 WP_002294561.1.15198 WP_002294561.1.15604 WP_002294561.1.15879 WP_002294561.1.16275 WP_002294561.1.16346 WP_002294561.1.16400 WP_002294561.1.16712 WP_002294561.1.16827 WP_002294561.1.17488 WP_002294561.1.17573 WP_002294561.1.17607 WP_002294561.1.17636 WP_002294561.1.17742 WP_002294561.1.1776 WP_002294561.1.17764 WP_002294561.1.17898 WP_002294561.1.17916 WP_002294561.1.18015 WP_002294561.1.18085 WP_002294561.1.18125 WP_002294561.1.18183 WP_002294561.1.18269 WP_002294561.1.18498 WP_002294561.1.18622 WP_002294561.1.18700 WP_002294561.1.1878 WP_002294561.1.19395 WP_002294561.1.19482 WP_002294561.1.19498 WP_002294561.1.19499 WP_002294561.1.19582 WP_002294561.1.19672 WP_002294561.1.19708 WP_002294561.1.19805 WP_002294561.1.19916 WP_002294561.1.20068 WP_002294561.1.20098 WP_002294561.1.201 WP_002294561.1.20150 WP_002294561.1.20485 WP_002294561.1.20747 WP_002294561.1.20896 WP_002294561.1.21108 WP_002294561.1.21268 WP_002294561.1.2133 WP_002294561.1.21545 WP_002294561.1.21659 WP_002294561.1.21664 WP_002294561.1.21769 WP_002294561.1.21951 WP_002294561.1.22311 WP_002294561.1.22488 WP_002294561.1.22873 WP_002294561.1.230 WP_002294561.1.23055 WP_002294561.1.23063 WP_002294561.1.23147 WP_002294561.1.23327 WP_002294561.1.23339 WP_002294561.1.23398 WP_002294561.1.23414 WP_002294561.1.23429 WP_002294561.1.23667 WP_002294561.1.23691 WP_002294561.1.23697 WP_002294561.1.23712 WP_002294561.1.23774 WP_002294561.1.238 WP_002294561.1.24193 WP_002294561.1.24789 WP_002294561.1.25011 WP_002294561.1.25014 WP_002294561.1.25022 WP_002294561.1.25113 WP_002294561.1.25133 WP_002294561.1.25166 WP_002294561.1.25521 WP_002294561.1.25533 WP_002294561.1.25646 WP_002294561.1.25648 WP_002294561.1.25676 WP_002294561.1.25691 WP_002294561.1.2628 WP_002294561.1.26372 WP_002294561.1.26478 WP_002294561.1.26559 WP_002294561.1.26561 WP_002294561.1.2657 WP_002294561.1.26860 WP_002294561.1.26902 WP_002294561.1.26937 WP_002294561.1.27035 WP_002294561.1.2733 WP_002294561.1.27407 WP_002294561.1.27429 WP_002294561.1.27702 WP_002294561.1.2773 WP_002294561.1.2798 WP_002294561.1.28012 WP_002294561.1.28072 WP_002294561.1.28262 WP_002294561.1.28359 WP_002294561.1.2864 WP_002294561.1.28685 WP_002294561.1.28737 WP_002294561.1.28873 WP_002294561.1.29053 WP_002294561.1.29064 WP_002294561.1.29345 WP_002294561.1.29432 WP_002294561.1.29641 WP_002294561.1.29776 WP_002294561.1.29901 WP_002294561.1.30001 WP_002294561.1.3001 WP_002294561.1.30069 WP_002294561.1.30223 WP_002294561.1.31003 WP_002294561.1.31073 WP_002294561.1.31502 WP_002294561.1.31583 WP_002294561.1.31636 WP_002294561.1.31923 WP_002294561.1.31965 WP_002294561.1.3216 WP_002294561.1.32195 WP_002294561.1.32291 WP_002294561.1.3246 WP_002294561.1.32727 WP_002294561.1.32753 WP_002294561.1.33090 WP_002294561.1.3313 WP_002294561.1.33173 WP_002294561.1.33231 WP_002294561.1.33273 WP_002294561.1.33323 WP_002294561.1.33478 WP_002294561.1.3348 WP_002294561.1.3352 WP_002294561.1.33590 WP_002294561.1.33593 WP_002294561.1.34020 WP_002294561.1.34221 WP_002294561.1.34354 WP_002294561.1.34691 WP_002294561.1.34701 WP_002294561.1.34980 WP_002294561.1.35140 WP_002294561.1.35158 WP_002294561.1.35212 WP_002294561.1.35302 WP_002294561.1.35456 WP_002294561.1.35788 WP_002294561.1.358 WP_002294561.1.35962 WP_002294561.1.36052 WP_002294561.1.36076 WP_002294561.1.36337 WP_002294561.1.36428 WP_002294561.1.36777 WP_002294561.1.36804 WP_002294561.1.37151 WP_002294561.1.37318 WP_002294561.1.37495 WP_002294561.1.37531 WP_002294561.1.37539 WP_002294561.1.37552 WP_002294561.1.37630 WP_002294561.1.38074 WP_002294561.1.38149 WP_002294561.1.38191 WP_002294561.1.38331 WP_002294561.1.38458 WP_002294561.1.38563 WP_002294561.1.38565 WP_002294561.1.38915 WP_002294561.1.38981 WP_002294561.1.39253 WP_002294561.1.3938 WP_002294561.1.39565 WP_002294561.1.39617 WP_002294561.1.39827 WP_002294561.1.40052 WP_002294561.1.40077 WP_002294561.1.40087 WP_002294561.1.40180 WP_002294561.1.4026 WP_002294561.1.40387 WP_002294561.1.40514 WP_002294561.1.40529 WP_002294561.1.40562 WP_002294561.1.40575 WP_002294561.1.40576 WP_002294561.1.40630 WP_002294561.1.4065 WP_002294561.1.40749 WP_002294561.1.4099 WP_002294561.1.41051 WP_002294561.1.41158 WP_002294561.1.41187 WP_002294561.1.4123 WP_002294561.1.41285 WP_002294561.1.41320 WP_002294561.1.41509 WP_002294561.1.4176 WP_002294561.1.41869 WP_002294561.1.4198 WP_002294561.1.4200 WP_002294561.1.42354 WP_002294561.1.42529 WP_002294561.1.43163 WP_002294561.1.43692 WP_002294561.1.43713 WP_002294561.1.43823 WP_002294561.1.43830 WP_002294561.1.44098 WP_002294561.1.44429 WP_002294561.1.44557 WP_002294561.1.44585 WP_002294561.1.44822 WP_002294561.1.44852 WP_002294561.1.44874 WP_002294561.1.44909 WP_002294561.1.44952 WP_002294561.1.45007 WP_002294561.1.45174 WP_002294561.1.45423 WP_002294561.1.4544 WP_002294561.1.45529 WP_002294561.1.45650 WP_002294561.1.45681 WP_002294561.1.45710 WP_002294561.1.45735 WP_002294561.1.45866 WP_002294561.1.45899 WP_002294561.1.46020 WP_002294561.1.46063 WP_002294561.1.46230 WP_002294561.1.46513 WP_002294561.1.46516 WP_002294561.1.46544 WP_002294561.1.46658 WP_002294561.1.4689 WP_002294561.1.46917 WP_002294561.1.47031 WP_002294561.1.47169 WP_002294561.1.47357 WP_002294561.1.47410 WP_002294561.1.47481 WP_002294561.1.47528 WP_002294561.1.47592 WP_002294561.1.47658 WP_002294561.1.47710 WP_002294561.1.47752 WP_002294561.1.47810 WP_002294561.1.47841 WP_002294561.1.47945 WP_002294561.1.47985 WP_002294561.1.48041 WP_002294561.1.48068 WP_002294561.1.48113 WP_002294561.1.48400 WP_002294561.1.48409 WP_002294561.1.48679 WP_002294561.1.48934 WP_002294561.1.49013 WP_002294561.1.491 WP_002294561.1.49384 WP_002294561.1.49395 WP_002294561.1.49529 WP_002294561.1.49691 WP_002294561.1.49926 WP_002294561.1.50112 WP_002294561.1.50124 WP_002294561.1.50286 WP_002294561.1.50414 WP_002294561.1.50550 WP_002294561.1.50609 WP_002294561.1.50809 WP_002294561.1.50878 WP_002294561.1.50891 WP_002294561.1.51199 WP_002294561.1.51252 WP_002294561.1.51584 WP_002294561.1.5159 WP_002294561.1.51612 WP_002294561.1.51895 WP_002294561.1.51972 WP_002294561.1.52099 WP_002294561.1.52153 WP_002294561.1.52239 WP_002294561.1.5246 WP_002294561.1.52683 WP_002294561.1.5286 WP_002294561.1.52912 WP_002294561.1.53033 WP_002294561.1.53801 WP_002294561.1.54012 WP_002294561.1.54167 WP_002294561.1.54270 WP_002294561.1.54339 WP_002294561.1.54461 WP_002294561.1.54852 WP_002294561.1.54853 WP_002294561.1.55044 WP_002294561.1.55260 WP_002294561.1.55308 WP_002294561.1.55462 WP_002294561.1.55697 WP_002294561.1.55962 WP_002294561.1.56471 WP_002294561.1.56539 WP_002294561.1.56694 WP_002294561.1.56718 WP_002294561.1.56820 WP_002294561.1.56838 WP_002294561.1.56895 WP_002294561.1.5700 WP_002294561.1.57144 WP_002294561.1.57467 WP_002294561.1.58120 WP_002294561.1.58377 WP_002294561.1.5839 WP_002294561.1.5863 WP_002294561.1.58750 WP_002294561.1.58779 WP_002294561.1.58804 WP_002294561.1.58928 WP_002294561.1.59891 WP_002294561.1.60393 WP_002294561.1.60535 WP_002294561.1.60612 WP_002294561.1.60821 WP_002294561.1.61331 WP_002294561.1.61798 WP_002294561.1.61826 WP_002294561.1.61884 WP_002294561.1.6200 WP_002294561.1.62072 WP_002294561.1.62123 WP_002294561.1.62179 WP_002294561.1.62353 WP_002294561.1.62385 WP_002294561.1.62406 WP_002294561.1.62582 WP_002294561.1.62584 WP_002294561.1.62626 WP_002294561.1.62679 WP_002294561.1.62930 WP_002294561.1.62957 WP_002294561.1.63089 WP_002294561.1.6311 WP_002294561.1.63121 WP_002294561.1.6344 WP_002294561.1.63523 WP_002294561.1.63595 WP_002294561.1.6363 WP_002294561.1.63877 WP_002294561.1.63994 WP_002294561.1.64083 WP_002294561.1.64252 WP_002294561.1.64454 WP_002294561.1.64934 WP_002294561.1.65160 WP_002294561.1.65170 WP_002294561.1.65360 WP_002294561.1.65424 WP_002294561.1.65447 WP_002294561.1.65502 WP_002294561.1.65521 WP_002294561.1.66042 WP_002294561.1.66284 WP_002294561.1.66419 WP_002294561.1.66493 WP_002294561.1.66649 WP_002294561.1.66963 WP_002294561.1.67032 WP_002294561.1.6709 WP_002294561.1.67125 WP_002294561.1.67168 WP_002294561.1.67311 WP_002294561.1.67323 WP_002294561.1.67331 WP_002294561.1.67385 WP_002294561.1.67518 WP_002294561.1.68042 WP_002294561.1.68129 WP_002294561.1.68536 WP_002294561.1.6855 WP_002294561.1.68696 WP_002294561.1.6870 WP_002294561.1.68836 WP_002294561.1.69084 WP_002294561.1.69201 WP_002294561.1.69436 WP_002294561.1.69533 WP_002294561.1.69633 WP_002294561.1.69879 WP_002294561.1.69897 WP_002294561.1.70021 WP_002294561.1.70076 WP_002294561.1.70109 WP_002294561.1.7025 WP_002294561.1.70405 WP_002294561.1.70468 WP_002294561.1.70482 WP_002294561.1.70506 WP_002294561.1.70697 WP_002294561.1.70998 WP_002294561.1.71049 WP_002294561.1.71107 WP_002294561.1.7137 WP_002294561.1.71588 WP_002294561.1.71593 WP_002294561.1.71743 WP_002294561.1.72036 WP_002294561.1.72110 WP_002294561.1.72195 WP_002294561.1.72273 WP_002294561.1.72658 WP_002294561.1.72807 WP_002294561.1.72952 WP_002294561.1.73077 WP_002294561.1.73151 WP_002294561.1.73179 WP_002294561.1.73250 WP_002294561.1.73552 WP_002294561.1.7372 WP_002294561.1.73997 WP_002294561.1.74022 WP_002294561.1.74093 WP_002294561.1.74527 WP_002294561.1.74707 WP_002294561.1.74749 WP_002294561.1.74824 WP_002294561.1.75235 WP_002294561.1.75278 WP_002294561.1.75417 WP_002294561.1.75535 WP_002294561.1.75579 WP_002294561.1.75619 WP_002294561.1.75916 WP_002294561.1.762 WP_002294561.1.76578 WP_002294561.1.76647 WP_002294561.1.76730 WP_002294561.1.77231 WP_002294561.1.7734 WP_002294561.1.77342 WP_002294561.1.77466 WP_002294561.1.77522 WP_002294561.1.7753 WP_002294561.1.77560 WP_002294561.1.77772 WP_002294561.1.77804 WP_002294561.1.77857 WP_002294561.1.78190 WP_002294561.1.78271 WP_002294561.1.78431 WP_002294561.1.78770 WP_002294561.1.78817 WP_002294561.1.78818 WP_002294561.1.78882 WP_002294561.1.78971 WP_002294561.1.7911 WP_002294561.1.79859 WP_002294561.1.80023 WP_002294561.1.80031 WP_002294561.1.80073 WP_002294561.1.80238 WP_002294561.1.80369 WP_002294561.1.80377 WP_002294561.1.80413 WP_002294561.1.81011 WP_002294561.1.81222 WP_002294561.1.81451 WP_002294561.1.81636 WP_002294561.1.81642 WP_002294561.1.81868 WP_002294561.1.81958 WP_002294561.1.82000 WP_002294561.1.82415 WP_002294561.1.8262 WP_002294561.1.82658 WP_002294561.1.82689 WP_002294561.1.82745 WP_002294561.1.82949 WP_002294561.1.83170 WP_002294561.1.83339 WP_002294561.1.83362 WP_002294561.1.83469 WP_002294561.1.83496 WP_002294561.1.83532 WP_002294561.1.83549 WP_002294561.1.83571 WP_002294561.1.83682 WP_002294561.1.83768 WP_002294561.1.8382 WP_002294561.1.83927 WP_002294561.1.83988 WP_002294561.1.84089 WP_002294561.1.84223 WP_002294561.1.84281 WP_002294561.1.84327 WP_002294561.1.8439 WP_002294561.1.84395 WP_002294561.1.84804 WP_002294561.1.85092 WP_002294561.1.85189 WP_002294561.1.85251 WP_002294561.1.85358 WP_002294561.1.85407 WP_002294561.1.85457 WP_002294561.1.8566 WP_002294561.1.85666 WP_002294561.1.85739 WP_002294561.1.86077 WP_002294561.1.86135 WP_002294561.1.8634 WP_002294561.1.86409 WP_002294561.1.86565 WP_002294561.1.86824 WP_002294561.1.86884 WP_002294561.1.86995 WP_002294561.1.87018 WP_002294561.1.87637 WP_002294561.1.87657 WP_002294561.1.87900 WP_002294561.1.87906 WP_002294561.1.87908 WP_002294561.1.88005 WP_002294561.1.88065 WP_002294561.1.88273 WP_002294561.1.88321 WP_002294561.1.88323 WP_002294561.1.88325 WP_002294561.1.88447 WP_002294561.1.88545 WP_002294561.1.88612 WP_002294561.1.88637 WP_002294561.1.88691 WP_002294561.1.88718 WP_002294561.1.89031 WP_002294561.1.89062 WP_002294561.1.89307 WP_002294561.1.89323 WP_002294561.1.89356 WP_002294561.1.89538 WP_002294561.1.89566 WP_002294561.1.89774 WP_002294561.1.89778 WP_002294561.1.89986 WP_002294561.1.90107 WP_002294561.1.90267 WP_002294561.1.90271 WP_002294561.1.90380 WP_002294561.1.90416 WP_002294561.1.90494 WP_002294561.1.90500 WP_002294561.1.9065 WP_002294561.1.9080 WP_002294561.1.90955 WP_002294561.1.91050 WP_002294561.1.9126 WP_002294561.1.91317 WP_002294561.1.91429 WP_002294561.1.91657 WP_002294561.1.91658 WP_002294561.1.91805 WP_002294561.1.91962 WP_002294561.1.92113 WP_002294561.1.92197 WP_002294561.1.92343 WP_002294561.1.92566 WP_002294561.1.9257 WP_002294561.1.92721 WP_002294561.1.9308 WP_002294561.1.93128 WP_002294561.1.93166 WP_002294561.1.93255 WP_002294561.1.93344 WP_002294561.1.93591 WP_002294561.1.93831 WP_002294561.1.93941 WP_002294561.1.9415 WP_002294561.1.94185 WP_002294561.1.94197 WP_002294561.1.94583 WP_002294561.1.94632 WP_002294561.1.94744 WP_002294561.1.94793 WP_002294561.1.94846 WP_002294561.1.95510 WP_002294561.1.95538 WP_002294561.1.95548 WP_002294561.1.95741 WP_002294561.1.96352 WP_002294561.1.96390 WP_002294561.1.96581 WP_002294561.1.96767 WP_002294561.1.96948 WP_002294561.1.97766 WP_002294561.1.97952 WP_002294561.1.98228 WP_002294561.1.9824 WP_002294561.1.98407 WP_002294561.1.98458 WP_002294561.1.98469 WP_002294561.1.98720 WP_002294561.1.9874 WP_002294561.1.98772 WP_002294561.1.9881 WP_002294561.1.98815 WP_002294561.1.98831 WP_002294561.1.98940 WP_002294561.1.99032 WP_002294561.1.9913 WP_002294561.1.99380 WP_002294561.1.99437 WP_002294561.1.9948 YP_006377020.1.11553 gi|447913681|ref|YP_007395093.1| gi|529235265|ref|YP_008396077.1| gi|389869597|ref|YP_006377020.1| gi|383329791|ref|YP_005355675.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]